Recombinant Human CD69 protein, His-tagged
| Cat.No. : | CD69-5844H |
| Product Overview : | Recombinant Human CD69 protein(Q07108)(64-199aa), fused with N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 64-199aa |
| Tag : | N-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.0 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK |
| Gene Name | CD69 CD69 molecule [ Homo sapiens ] |
| Official Symbol | CD69 |
| Synonyms | CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; leukocyte surface antigen Leu-23; early T-cell activation antigen p60; early lymphocyte activation antigen; activation inducer molecule (AIM/CD69); C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell activation antigen); AIM; EA1; MLR-3; GP32/28; BL-AC/P26; |
| Gene ID | 969 |
| mRNA Refseq | NM_001781 |
| Protein Refseq | NP_001772 |
| MIM | 107273 |
| UniProt ID | Q07108 |
| ◆ Recombinant Proteins | ||
| CD69-34H | Recombinant Human CD69 Protein, His-tagged | +Inquiry |
| CD69-1802R | Recombinant Rhesus Monkey CD69 Protein, hIgG1-tagged | +Inquiry |
| CD69-3028HF | Recombinant Full Length Human CD69 Protein, GST-tagged | +Inquiry |
| CD69-3101H | Recombinant Human CD69 Protein, MYC/DDK-tagged | +Inquiry |
| CD69-3609C | Recombinant Chicken CD69 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD69-2573HCL | Recombinant Human CD69 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD69 Products
Required fields are marked with *
My Review for All CD69 Products
Required fields are marked with *



