Recombinant Human CD69 protein, His-tagged
Cat.No. : | CD69-5844H |
Product Overview : | Recombinant Human CD69 protein(Q07108)(64-199aa), fused with N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 64-199aa |
Tag : | N-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK |
Gene Name | CD69 CD69 molecule [ Homo sapiens ] |
Official Symbol | CD69 |
Synonyms | CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; leukocyte surface antigen Leu-23; early T-cell activation antigen p60; early lymphocyte activation antigen; activation inducer molecule (AIM/CD69); C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell activation antigen); AIM; EA1; MLR-3; GP32/28; BL-AC/P26; |
Gene ID | 969 |
mRNA Refseq | NM_001781 |
Protein Refseq | NP_001772 |
MIM | 107273 |
UniProt ID | Q07108 |
◆ Recombinant Proteins | ||
CD69-1487C | Recombinant Cynomolgus CD69 protein, His-tagged | +Inquiry |
RFL27501MF | Recombinant Full Length Mouse Early Activation Antigen Cd69(Cd69) Protein, His-Tagged | +Inquiry |
CD69-3609C | Recombinant Chicken CD69 | +Inquiry |
Cd69-4522H | Recombinant Human Cd69 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
CD69-3101H | Recombinant Human CD69 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD69-2573HCL | Recombinant Human CD69 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD69 Products
Required fields are marked with *
My Review for All CD69 Products
Required fields are marked with *