Recombinant Human CD72 Protein, GST-Tagged
Cat.No. : | CD72-0853H |
Product Overview : | Human CD72 full-length ORF (AAH30227.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CD72 (CD72 Molecule) is a Protein Coding gene. Diseases associated with CD72 include Small Intestine Lymphoma and Chronic Lymphocytic Leukemia. Among its related pathways are Natural Killer Cell Receptors: Human Target Cell – NK Cell Ligand-Receptor Interactions and Developmental Biology. GO annotations related to this gene include receptor binding and carbohydrate binding. |
Molecular Mass : | 65.89 kDa |
AA Sequence : | MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD72 CD72 molecule [ Homo sapiens ] |
Official Symbol | CD72 |
Synonyms | CD72; CD72 molecule; CD72 antigen; B-cell differentiation antigen CD72; CD72b; LYB2; lyb-2; |
Gene ID | 971 |
mRNA Refseq | NM_001782 |
Protein Refseq | NP_001773 |
MIM | 107272 |
UniProt ID | P21854 |
◆ Recombinant Proteins | ||
CD72-1809R | Recombinant Rhesus Monkey CD72 Protein, hIgG4-tagged | +Inquiry |
RFL21534MF | Recombinant Full Length Mouse B-Cell Differentiation Antigen Cd72(Cd72) Protein, His-Tagged | +Inquiry |
CD72-270HA | Recombinant Human CD72 protein, Fc-tagged, APC labeled | +Inquiry |
CD72-271H | Recombinant Human CD72 protein, Trx-His-tagged | +Inquiry |
CD72-1807R | Recombinant Rhesus Monkey CD72 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD72-7674HCL | Recombinant Human CD72 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD72 Products
Required fields are marked with *
My Review for All CD72 Products
Required fields are marked with *
0
Inquiry Basket