Recombinant Human CD72 Protein, GST-Tagged
| Cat.No. : | CD72-0853H |
| Product Overview : | Human CD72 full-length ORF (AAH30227.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CD72 (CD72 Molecule) is a Protein Coding gene. Diseases associated with CD72 include Small Intestine Lymphoma and Chronic Lymphocytic Leukemia. Among its related pathways are Natural Killer Cell Receptors: Human Target Cell – NK Cell Ligand-Receptor Interactions and Developmental Biology. GO annotations related to this gene include receptor binding and carbohydrate binding. |
| Molecular Mass : | 65.89 kDa |
| AA Sequence : | MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CD72 CD72 molecule [ Homo sapiens ] |
| Official Symbol | CD72 |
| Synonyms | CD72; CD72 molecule; CD72 antigen; B-cell differentiation antigen CD72; CD72b; LYB2; lyb-2; |
| Gene ID | 971 |
| mRNA Refseq | NM_001782 |
| Protein Refseq | NP_001773 |
| MIM | 107272 |
| UniProt ID | P21854 |
| ◆ Recombinant Proteins | ||
| CD72-271H | Recombinant Human CD72 protein, Trx-His-tagged | +Inquiry |
| CD72-1808R | Recombinant Rhesus Monkey CD72 Protein, hIgG1-tagged | +Inquiry |
| CD72-270HF | Recombinant Human CD72 Protein, hFc-tagged, FITC conjugated | +Inquiry |
| CD72-854HF | Recombinant Human CD72 protein, Fc-tagged, FITC-labeled | +Inquiry |
| CD72-2991H | Recombinant Human CD72 protein, mFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD72-7674HCL | Recombinant Human CD72 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD72 Products
Required fields are marked with *
My Review for All CD72 Products
Required fields are marked with *
