Recombinant Human CD72 protein, Trx-His-tagged

• Cat.No.: CD72-271H
• Product Overview: Recombinant Human CD72 fused with Trx-His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Trx
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 30.6kD
• AA Sequence: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQ
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: CD72 CD72 molecule [ Homo sapiens ]
• Official Symbol: CD72
• Synonyms: CD72; CD72 molecule; CD72 antigen; B-cell differentiation antigen CD72; CD72b; LYB2; lyb-2
• Gene ID: 971
• mRNA Refseq: NM_001782
• Protein Refseq: NP_001773
• MIM: 107272
• UniProt ID: P21854