Recombinant Human CD72 protein, Trx-His-tagged
| Cat.No. : | CD72-271H |
| Product Overview : | Recombinant Human CD72 fused with Trx-His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Trx |
| Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
| Molecular Mass : | 30.6kD |
| AA Sequence : | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQ |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | CD72 CD72 molecule [ Homo sapiens ] |
| Official Symbol | CD72 |
| Synonyms | CD72; CD72 molecule; CD72 antigen; B-cell differentiation antigen CD72; CD72b; LYB2; lyb-2; |
| Gene ID | 971 |
| mRNA Refseq | NM_001782 |
| Protein Refseq | NP_001773 |
| MIM | 107272 |
| UniProt ID | P21854 |
| ◆ Recombinant Proteins | ||
| CD72-854HF | Recombinant Human CD72 protein, Fc-tagged, FITC-labeled | +Inquiry |
| CD72-207H | Recombinant Human CD72 Protein, C-His-tagged | +Inquiry |
| CD72-3746H | Recombinant Human CD72 protein, rFc-tagged | +Inquiry |
| CD72-2992H | Recombinant Human CD72 protein, His-tagged | +Inquiry |
| CD72-270HA | Recombinant Human CD72 protein, Fc-tagged, APC labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD72-7674HCL | Recombinant Human CD72 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD72 Products
Required fields are marked with *
My Review for All CD72 Products
Required fields are marked with *
