Recombinant Human CD72 protein, Trx-His-tagged
Cat.No. : | CD72-271H |
Product Overview : | Recombinant Human CD72 fused with Trx-His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Trx |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 30.6kD |
AA Sequence : | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQ |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | CD72 CD72 molecule [ Homo sapiens ] |
Official Symbol | CD72 |
Synonyms | CD72; CD72 molecule; CD72 antigen; B-cell differentiation antigen CD72; CD72b; LYB2; lyb-2; |
Gene ID | 971 |
mRNA Refseq | NM_001782 |
Protein Refseq | NP_001773 |
MIM | 107272 |
UniProt ID | P21854 |
◆ Recombinant Proteins | ||
CD72-5368H | Recombinant Human CD72 Protein (Arg117-Asp359), C-His tagged | +Inquiry |
CD72-2994H | Recombinant Human CD72 protein, Fc-tagged | +Inquiry |
CD72-270HF | Recombinant Human CD72 Protein, hFc-tagged, FITC conjugated | +Inquiry |
CD72-1808R | Recombinant Rhesus Monkey CD72 Protein, hIgG1-tagged | +Inquiry |
CD72-4268H | Recombinant Human CD72 molecule | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD72-7674HCL | Recombinant Human CD72 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD72 Products
Required fields are marked with *
My Review for All CD72 Products
Required fields are marked with *
0
Inquiry Basket