Recombinant Human CD74
Cat.No. : | CD74-2229H |
Product Overview : | Recombinant Human CD74 encoding full-length Human CD74was expressed in Wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. |
Sequence : | MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV |
MW (kDa) : | 18.3 |
Form : | Liquid |
Applications : | Antibody Production; Functional Study; Compound Screening |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CD74 CD74 molecule, major histocompatibility complex, class II invariant chain [ Homo sapiens ] |
Official Symbol | CD74 |
Synonyms | CD74 molecule, major histocompatibility complex, class II invariant chain; DHLAG; HLADG; Ia-GAMMA; CD74; HLA class II histocompatibility antigen gamma chain; ii; p33; HLA-DR-gamma; MHC HLA-DR gamma chain; Ia-associated invariant chain; gamma chain of class II antigens; ia antigen-associated invariant chain; HLA-DR antigens-associated invariant chain; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); CD74 antigen |
Gene ID | 972 |
mRNA Refseq | NM_004355 |
Protein Refseq | NP_004346 |
MIM | 142790 |
UniProt ID | P04233 |
Chromosome Location | 5q32 |
Pathway | Antigen processing and presentation |
Function | MHC class II protein binding; beta-amyloid binding; cytokine binding; cytokine receptor activity; identical protein binding |
◆ Recombinant Proteins | ||
Cd74-7854M | Recombinant Mouse Cd74 protein, His-tagged | +Inquiry |
CD74-920R | Recombinant Rat CD74 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD74-2231H | Active Recombinant Human CD74, Hemagglutinin-tagged | +Inquiry |
CD74-1132C | Recombinant Chicken CD74 | +Inquiry |
CD74-1262R | Recombinant Rat CD74 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD74-2603HCL | Recombinant Human CD74 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD74 Products
Required fields are marked with *
My Review for All CD74 Products
Required fields are marked with *