Recombinant Human CD79B protein, T7/His-tagged
| Cat.No. : | CD79B-89H |
| Product Overview : | Recombinant human CD79B cDNA (29 – 159aa, derived from BC032651) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 29-159 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNV SWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLA QLKQRNTLKD |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro human CD79B mediated B cell differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD79B protein-protein interaction assay development.3. Potential biomarker protein for plasma cell myeloma.4. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ] |
| Official Symbol | CD79B |
| Synonyms | CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29; Ig-beta; B-cell-specific glycoprotein B29; immunoglobulin-associated B29 prote |
| Gene ID | 974 |
| mRNA Refseq | NM_000626 |
| Protein Refseq | NP_000617 |
| MIM | 147245 |
| UniProt ID | P40259 |
| Chromosome Location | 17q23 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem |
| Function | transmembrane signaling receptor activity; |
| ◆ Recombinant Proteins | ||
| Cd79b-7487R | Recombinant Rat Cd79b, Fc-tagged | +Inquiry |
| CD79B-238H | Recombinant Human CD79B protein, His-tagged | +Inquiry |
| CD79B-0742H | Recombinant Human CD79B Protein (Asn37-Pro226), N-His tagged | +Inquiry |
| CD79B-3749H | Recombinant Human CD79B protein, rFc-tagged | +Inquiry |
| Cd79b-6897M | Recombinant Mouse Cd79b protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD79B-1323RCL | Recombinant Rat CD79B cell lysate | +Inquiry |
| CD79B-1827MCL | Recombinant Mouse CD79B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD79B Products
Required fields are marked with *
My Review for All CD79B Products
Required fields are marked with *



