Recombinant Human CD79B protein, T7/His-tagged

Cat.No. : CD79B-89H
Product Overview : Recombinant human CD79B cDNA (29 – 159aa, derived from BC032651) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 29-159 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNV SWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLA QLKQRNTLKD
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human CD79B mediated B cell differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD79B protein-protein interaction assay development.3. Potential biomarker protein for plasma cell myeloma.4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ]
Official Symbol CD79B
Synonyms CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29; Ig-beta; B-cell-specific glycoprotein B29; immunoglobulin-associated B29 prote
Gene ID 974
mRNA Refseq NM_000626
Protein Refseq NP_000617
MIM 147245
UniProt ID P40259
Chromosome Location 17q23
Pathway Adaptive Immune System, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem
Function transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD79B Products

Required fields are marked with *

My Review for All CD79B Products

Required fields are marked with *

0
cart-icon
0
compare icon