Recombinant Human CD79B protein, T7/His-tagged
Cat.No. : | CD79B-89H |
Product Overview : | Recombinant human CD79B cDNA (29 – 159aa, derived from BC032651) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 29-159 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNV SWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLA QLKQRNTLKD |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human CD79B mediated B cell differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD79B protein-protein interaction assay development.3. Potential biomarker protein for plasma cell myeloma.4. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ] |
Official Symbol | CD79B |
Synonyms | CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29; Ig-beta; B-cell-specific glycoprotein B29; immunoglobulin-associated B29 prote |
Gene ID | 974 |
mRNA Refseq | NM_000626 |
Protein Refseq | NP_000617 |
MIM | 147245 |
UniProt ID | P40259 |
Chromosome Location | 17q23 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem |
Function | transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
CD79B-397H | Recombinant Human CD79b molecule, immunoglobulin-associated beta, His-tagged | +Inquiry |
Cd79b-8776R | Recombinant Rat Cd79b protein(Met1-Asp158), His-tagged | +Inquiry |
CD79B-239HF | Recombinant Human CD79B Protein, hFc-tagged, FITC conjugated | +Inquiry |
Cd79b-1222M | Recombinant Mouse Cd79b Protein, MYC/DDK-tagged | +Inquiry |
CD79B-3113H | Recombinant Human CD79B Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD79B-1827MCL | Recombinant Mouse CD79B cell lysate | +Inquiry |
CD79B-1323RCL | Recombinant Rat CD79B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD79B Products
Required fields are marked with *
My Review for All CD79B Products
Required fields are marked with *