"CD79B" Related Products

Expand
Expand

Recombinant Human CD79B protein, T7/His-tagged

Cat.No.: CD79B-89H
Product Overview: Recombinant human CD79B cDNA (29 – 159aa, derived from BC032651) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNV SWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLA QLKQRNTLKD
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro human CD79B mediated B cell differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD79B protein-protein interaction assay development.3. Potential biomarker protein for plasma cell myeloma.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ]
Official Symbol: CD79B
Synonyms: CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29; Ig-beta; B-cell-specific glycoprotein B29; immunoglobulin-associated B29 prote
Gene ID: 974
mRNA Refseq: NM_000626
Protein Refseq: NP_000617
MIM: 147245
UniProt ID: P40259
Chromosome Location: 17q23
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem
Function: transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.