Recombinant Human CD83 protein, GST-tagged
| Cat.No. : | CD83-301473H |
| Product Overview : | Recombinant Human CD83 (22-144 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Glu22-Glu144 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | EVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | CD83 CD83 molecule [ Homo sapiens ] |
| Official Symbol | CD83 |
| Synonyms | CD83; CD83 molecule; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) , CD83 molecule; CD83 antigen; BL11; HB15; hCD83; B-cell activation protein; cell surface protein HB15; cell-surface glycoprotein; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); |
| Gene ID | 9308 |
| mRNA Refseq | NM_001040280 |
| Protein Refseq | NP_001035370 |
| MIM | 604534 |
| UniProt ID | Q01151 |
| ◆ Recombinant Proteins | ||
| Cd83-7489R | Recombinant Rat Cd83 protein(Met1-Ala134), hFc-tagged | +Inquiry |
| CD83-3751H | Recombinant Human CD83 protein, rFc-tagged | +Inquiry |
| CD83-5316H | Recombinant Human CD83 Protein (Met1-Ala143), C-His tagged | +Inquiry |
| CD83-051H | Recombinant Human CD83 Protein, Fc-tagged | +Inquiry |
| Cd83-6899M | Recombinant Mouse Cd83 protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
| CD83-1845MCL | Recombinant Mouse CD83 cell lysate | +Inquiry |
| CD83-1432RCL | Recombinant Rat CD83 cell lysate | +Inquiry |
| CD83-1130CCL | Recombinant Cynomolgus CD83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD83 Products
Required fields are marked with *
My Review for All CD83 Products
Required fields are marked with *
