Recombinant Human CD83 Protein, His-tagged
Cat.No. : | CD83-172H |
Product Overview : | Recombinant human CD83 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 205 |
Description : | The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD83 CD83 molecule [ Homo sapiens (human) ] |
Official Symbol | CD83 |
Synonyms | CD83; CD83 molecule; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) , CD83 molecule; CD83 antigen; BL11; HB15; hCD83; B-cell activation protein; cell surface protein HB15; cell-surface glycoprotein; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); |
Gene ID | 9308 |
mRNA Refseq | NM_001040280 |
Protein Refseq | NP_001035370 |
MIM | 604534 |
UniProt ID | Q01151 |
◆ Recombinant Proteins | ||
CD83-5316H | Recombinant Human CD83 Protein (Met1-Ala143), C-His tagged | +Inquiry |
Cd83-8777R | Recombinant Rat Cd83 protein(Met1-Ala134), His-tagged | +Inquiry |
CD83-5952H | Recombinant Human CD83 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL1351MF | Recombinant Full Length Mouse Cd83 Antigen(Cd83) Protein, His-Tagged | +Inquiry |
CD83-7225H | Recombinant Human CD83, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD83-1130CCL | Recombinant Cynomolgus CD83 cell lysate | +Inquiry |
CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
CD83-1432RCL | Recombinant Rat CD83 cell lysate | +Inquiry |
CD83-1845MCL | Recombinant Mouse CD83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD83 Products
Required fields are marked with *
My Review for All CD83 Products
Required fields are marked with *
0
Inquiry Basket