Recombinant Human CD83 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CD83-5432H
Product Overview : CD83 MS Standard C13 and N15-labeled recombinant protein (NP_004224) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 23 kDa
AA Sequence : MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CD83 CD83 molecule [ Homo sapiens (human) ]
Official Symbol CD83
Synonyms CD83; CD83 molecule; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily), CD83 molecule; CD83 antigen; BL11; HB15; hCD83; B-cell activation protein; cell surface protein HB15; cell-surface glycoprotein; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily);
Gene ID 9308
mRNA Refseq NM_004233
Protein Refseq NP_004224
MIM 604534
UniProt ID Q01151

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD83 Products

Required fields are marked with *

My Review for All CD83 Products

Required fields are marked with *

0
cart-icon