Recombinant Human CD83 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CD83-5432H |
Product Overview : | CD83 MS Standard C13 and N15-labeled recombinant protein (NP_004224) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 23 kDa |
AA Sequence : | MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CD83 CD83 molecule [ Homo sapiens (human) ] |
Official Symbol | CD83 |
Synonyms | CD83; CD83 molecule; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily), CD83 molecule; CD83 antigen; BL11; HB15; hCD83; B-cell activation protein; cell surface protein HB15; cell-surface glycoprotein; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); |
Gene ID | 9308 |
mRNA Refseq | NM_004233 |
Protein Refseq | NP_004224 |
MIM | 604534 |
UniProt ID | Q01151 |
◆ Recombinant Proteins | ||
CD83-051H | Recombinant Human CD83 Protein, Fc-tagged | +Inquiry |
Cd83-850M | Recombinant Mouse Cd83 Protein, MYC/DDK-tagged | +Inquiry |
Cd83-8777R | Recombinant Rat Cd83 protein(Met1-Ala134), His-tagged | +Inquiry |
CD83-0869H | Recombinant Human CD83 Protein, GST-Tagged | +Inquiry |
CD83-5316H | Recombinant Human CD83 Protein (Met1-Ala143), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
CD83-1130CCL | Recombinant Cynomolgus CD83 cell lysate | +Inquiry |
CD83-1432RCL | Recombinant Rat CD83 cell lysate | +Inquiry |
CD83-1845MCL | Recombinant Mouse CD83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD83 Products
Required fields are marked with *
My Review for All CD83 Products
Required fields are marked with *
0
Inquiry Basket