Recombinant Human CD84 Protein, GST-Tagged
Cat.No. : | CD84-0871H |
Product Overview : | Human CD84 full-length ORF (NP_003865.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011] |
Molecular Mass : | 63.3 kDa |
AA Sequence : | MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD84 CD84 molecule [ Homo sapiens ] |
Official Symbol | CD84 |
Synonyms | CD84; CD84 molecule; CD84 antigen (leukocyte antigen), CD84 molecule; SLAM family member 5; hCD84; mCD84; SLAMF5; hly9-beta; leukocyte antigen CD84; cell surface antigen MAX.3; CD84 antigen (leukocyte antigen); leucocyte differentiation antigen CD84; leukocyte differentiation antigen CD84; signaling lymphocytic activation molecule 5; LY9B; DKFZp781E2378; |
Gene ID | 8832 |
mRNA Refseq | NM_001184879 |
Protein Refseq | NP_001171808 |
MIM | 604513 |
UniProt ID | Q9UIB8 |
◆ Recombinant Proteins | ||
CD84-3108H | Recombinant Human CD84 Protein, MYC/DDK-tagged | +Inquiry |
CD84-3043H | Recombinant Human CD84 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD84-58H | Recombinant Human CD84 protein, His-tagged | +Inquiry |
CD84-1417H | Recombinant Human CD84 Protein (Ile43-Leu248), N-His tagged | +Inquiry |
CD84-7167H | Recombinant Human CD84 molecule, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD84-1129CCL | Recombinant Cynomolgus CD84 cell lysate | +Inquiry |
CD84-1733MCL | Recombinant Mouse CD84 cell lysate | +Inquiry |
CD84-3041HCL | Recombinant Human CD84 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD84 Products
Required fields are marked with *
My Review for All CD84 Products
Required fields are marked with *