"CD9" Related Products

Expand
Expand
Expand

Recombinant Human CD9 Protein, GST-Tagged

Cat.No. : CD9-0882H
Product Overview : Human CD9 full-length ORF (NP_001760.1, 1 a.a. - 228 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 51.8 kDa
AA Sequence : MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CD9 CD9 molecule [ Homo sapiens ]
Official Symbol : CD9
Synonyms : CD9; CD9 molecule; CD9 antigen (p24), MIC3; CD9 antigen; BA2; motility related protein 1; MRP 1; P24; TSPAN29; 5H9 antigen; tetraspanin-29; BA-2/p24 antigen; CD9 antigen (p24); leukocyte antigen MIC3; motility related protein-1; cell growth-inhibiting gene 2 protein; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN-29; FLJ99568;
Gene ID : 928
mRNA Refseq : NM_001769
Protein Refseq : NP_001760
MIM : 143030
UniProt ID : P21926

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.