Recombinant Human CD9 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CD9-2958H |
Product Overview : | CD9 MS Standard C13 and N15-labeled recombinant protein (NP_001760) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. |
Molecular Mass : | 25.4 kDa |
AA Sequence : | MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSTILCCAIRRNREMVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CD9 CD9 molecule [ Homo sapiens (human) ] |
Official Symbol | CD9 |
Synonyms | CD9; CD9 molecule; CD9 antigen (p24), MIC3; CD9 antigen; BA2; motility related protein 1; MRP 1; P24; TSPAN29; 5H9 antigen; tetraspanin-29; BA-2/p24 antigen; CD9 antigen (p24); leukocyte antigen MIC3; motility related protein-1; cell growth-inhibiting gene 2 protein; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN-29; FLJ99568; |
Gene ID | 928 |
mRNA Refseq | NM_001769 |
Protein Refseq | NP_001760 |
MIM | 143030 |
UniProt ID | P21926 |
◆ Recombinant Proteins | ||
CD9-151H | Recombinant Human CD9 Protein, DYKDDDDK-tagged | +Inquiry |
CD9-3116M | Recombinant Mouse CD9 Protein | +Inquiry |
RFL13136CF | Recombinant Full Length Chlorocebus Aethiops Cd9 Antigen(Cd9) Protein, His-Tagged | +Inquiry |
CD9-549H | Recombinant Human CD9 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD9-0882H | Recombinant Human CD9 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD9-2110HCL | Recombinant Human CD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD9 Products
Required fields are marked with *
My Review for All CD9 Products
Required fields are marked with *