Recombinant Human CD9 Protein, C-His-tagged
Cat.No. : | CD9-178H |
Product Overview : | Recombinant Human CD9 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The CD9 antigen belongs to the tetraspanin family of cell surface glycoproteins, and is characterized by four transmembrane domains, one short extracellular domain (ECL1), and one long extracellular domain (ECL2). Tetraspanins interact with a variety of cell surface proteins and intracellular signaling molecules in specialized tetraspanin-enriched microdomains (TEMs), where they mediate a range of processes including adhesion, motility, membrane organization, and signal transduction. Research studies demonstrate that CD9 expression on the egg is required for gamete fusion during fertilization. CD9 was also shown to play a role in dendritic cell migration, megakaryocyte differentiation, and homing of cord blood CD34+ hematopoietic progenitors to the bone marrow. In addition, down regulation of CD9 expression is associated with poor prognosis and progression of several types of cancer. Additional research identified CD9 as an abundant component of exosomes, and may play some role in the fusion of these secreted membrane vesicles with recipient cells. |
Molecular Mass : | ~9 kDa |
AA Sequence : | SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD9 CD9 molecule [ Homo sapiens (human) ] |
Official Symbol | CD9 |
Synonyms | CD9; CD9 molecule; CD9 antigen (p24) , MIC3; CD9 antigen; BA2; motility related protein 1; MRP 1; P24; TSPAN29; 5H9 antigen; tetraspanin-29; BA-2/p24 antigen; CD9 antigen (p24); leukocyte antigen MIC3; motility related protein-1; cell growth-inhibiting gene 2 protein; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN-29; FLJ99568; |
Gene ID | 928 |
mRNA Refseq | NM_001769 |
Protein Refseq | NP_001760 |
MIM | 143030 |
UniProt ID | P21926 |
◆ Cell & Tissue Lysates | ||
CD9-2110HCL | Recombinant Human CD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD9 Products
Required fields are marked with *
My Review for All CD9 Products
Required fields are marked with *