Recombinant Human CD93, His-tagged

• Cat.No.: CD93-60H
• Product Overview: Recombinant Human Complement Component C1q Receptor/C1QR1 is produced with our mammalian expression system in HE293. The target protein is expressed with sequence (A24-K580) of Human C1QR1 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 24-580 a.a.
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• AA Sequence: ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTA RMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLL PSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFA SAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSF LCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDE CQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEE GYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPS GPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGV WREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: CD93 CD93 molecule [ Homo sapiens ]
• Official Symbol: CD93
• Synonyms: CD93; CD93 molecule; C1QR1, CD93 antigen , complement component 1, q subcomponent, receptor 1 , matrix remodelling associated 4 , MXRA4; complement component C1q receptor; C1qR(P); C1qRP; CDw93; dJ737E23.1; ECSM3; C1qR; CD93 antigen; C1q receptor 1; C1q/MBL/SPA receptor; matrix-remodelling associated 4; matrix-remodeling-associated protein 4; complement component 1 q subcomponent receptor 1; complement component 1, q subcomponent, receptor 1; C1QR1; MXRA4
• Gene ID: 22918
• mRNA Refseq: NM_012072
• Protein Refseq: NP_036204
• MIM: 120577
• UniProt ID: Q9NPY3
• Chromosome Location: 20p11.21
• Function: calcium ion binding; complement component C1q binding; protein binding; receptor activity; sugar binding