Recombinant Human CD93, His-tagged
Cat.No. : | CD93-60H |
Product Overview : | Recombinant Human Complement Component C1q Receptor/C1QR1 is produced with our mammalian expression system in HE293. The target protein is expressed with sequence (A24-K580) of Human C1QR1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-580 a.a. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTA RMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLL PSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFA SAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSF LCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDE CQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEE GYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPS GPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGV WREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | CD93 CD93 molecule [ Homo sapiens ] |
Official Symbol | CD93 |
Synonyms | CD93; CD93 molecule; C1QR1, CD93 antigen , complement component 1, q subcomponent, receptor 1 , matrix remodelling associated 4 , MXRA4; complement component C1q receptor; C1qR(P); C1qRP; CDw93; dJ737E23.1; ECSM3; C1qR; CD93 antigen; C1q receptor 1; C1q/MBL/SPA receptor; matrix-remodelling associated 4; matrix-remodeling-associated protein 4; complement component 1 q subcomponent receptor 1; complement component 1, q subcomponent, receptor 1; C1QR1; MXRA4; |
Gene ID | 22918 |
mRNA Refseq | NM_012072 |
Protein Refseq | NP_036204 |
MIM | 120577 |
UniProt ID | Q9NPY3 |
Chromosome Location | 20p11.21 |
Function | calcium ion binding; complement component C1q binding; protein binding; receptor activity; sugar binding; |
◆ Recombinant Proteins | ||
Cd93-7276M | Recombinant Mouse Cd93 Protein, His-tagged | +Inquiry |
CD93-3927M | Recombinant Mouse CD93 protein, His-tagged | +Inquiry |
CD93-4353C | Recombinant Cynomolgus monkey CD93 protein, His-tagged | +Inquiry |
CD93-3003H | Active Recombinant Human CD93 protein, His-tagged | +Inquiry |
CD93-10985H | Recombinant Human CD93, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD93-1824HCL | Recombinant Human CD93 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD93 Products
Required fields are marked with *
My Review for All CD93 Products
Required fields are marked with *