Recombinant Human CD97
Cat.No. : | CD97-26331TH |
Product Overview : | Recombinant fragment of Human CD97 (aa 421-529) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 109 amino acids |
Description : | This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19. |
Molecular Weight : | 37.620kDa inclusive of tags |
Tissue specificity : | Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastric, esophageal and p |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNS PILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLCAFWKS DSDRGGHWATEGCQVLGSKNGSTTCQCSH |
Sequence Similarities : | Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.Contains 5 EGF-like domains.Contains 1 GPS domain. |
Gene Name | CD97 CD97 molecule [ Homo sapiens ] |
Official Symbol | CD97 |
Synonyms | CD97; CD97 molecule; CD97 antigen; leukocyte antigen CD97; seven transmembrane helix receptor; seven span transmembrane protein; seven transmembrane; heterodimeric receptor associated with inflammation; TM7LN1; |
Gene ID | 976 |
mRNA Refseq | NM_001025160 |
Protein Refseq | NP_001020331 |
MIM | 601211 |
Uniprot ID | P48960 |
Chromosome Location | 19p13 |
Pathway | Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem; |
Function | G-protein coupled receptor activity; calcium ion binding; receptor activity; signal transducer activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
RFL19465BF | Recombinant Full Length Bovine Cd97 Antigen(Cd97) Protein, His-Tagged | +Inquiry |
Cd97-298M | Active Recombinant Mouse Cd97, His-tagged | +Inquiry |
RFL36560HF | Recombinant Full Length Human Cd97 Antigen(Cd97) Protein, His-Tagged | +Inquiry |
CD97-0889H | Recombinant Human CD97 Protein, GST-Tagged | +Inquiry |
CD97-26331TH | Recombinant Human CD97 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD97-2475HCL | Recombinant Human CD97 cell lysate | +Inquiry |
CD97-2207HCL | Recombinant Human CD97 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD97 Products
Required fields are marked with *
My Review for All CD97 Products
Required fields are marked with *