Recombinant Human CDAN1 Protein, GST-Tagged

• Cat.No.: CDAN1-0897H
• Product Overview: Human CDAN1 partial ORF (NP_612486.2, 1130 a.a. - 1227 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that appears to play a role in nuclear envelope integrity, possibly related to microtubule attachments. Mutations in this gene cause congenital dyserythropoietic anemia type I, a disease resulting in morphological and functional abnormalities of erythropoiesis. [provided by RefSeq, Jul 2009]
• Molecular Mass: 36.52 kDa
• AA Sequence: PLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDAN1 congenital dyserythropoietic anemia, type I [ Homo sapiens ]
• Official Symbol: CDAN1
• Synonyms: CDAN1; congenital dyserythropoietic anemia, type I; codanin-1; CDA I; CDAI; discs lost homolog; DLT; CDA1; PRO1295
• Gene ID: 146059
• mRNA Refseq: NM_138477
• Protein Refseq: NP_612486
• MIM: 607465
• UniProt ID: Q8IWY9