Recombinant Human CDAN1 Protein, GST-Tagged

Cat.No. : CDAN1-0897H
Product Overview : Human CDAN1 partial ORF (NP_612486.2, 1130 a.a. - 1227 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that appears to play a role in nuclear envelope integrity, possibly related to microtubule attachments. Mutations in this gene cause congenital dyserythropoietic anemia type I, a disease resulting in morphological and functional abnormalities of erythropoiesis. [provided by RefSeq, Jul 2009]
Molecular Mass : 36.52 kDa
AA Sequence : PLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDAN1 congenital dyserythropoietic anemia, type I [ Homo sapiens ]
Official Symbol CDAN1
Synonyms CDAN1; congenital dyserythropoietic anemia, type I; codanin-1; CDA I; CDAI; discs lost homolog; DLT; CDA1; PRO1295;
Gene ID 146059
mRNA Refseq NM_138477
Protein Refseq NP_612486
MIM 607465
UniProt ID Q8IWY9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDAN1 Products

Required fields are marked with *

My Review for All CDAN1 Products

Required fields are marked with *

0
cart-icon