Recombinant Human CDAN1 Protein, GST-Tagged
Cat.No. : | CDAN1-0897H |
Product Overview : | Human CDAN1 partial ORF (NP_612486.2, 1130 a.a. - 1227 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that appears to play a role in nuclear envelope integrity, possibly related to microtubule attachments. Mutations in this gene cause congenital dyserythropoietic anemia type I, a disease resulting in morphological and functional abnormalities of erythropoiesis. [provided by RefSeq, Jul 2009] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | PLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDAN1 congenital dyserythropoietic anemia, type I [ Homo sapiens ] |
Official Symbol | CDAN1 |
Synonyms | CDAN1; congenital dyserythropoietic anemia, type I; codanin-1; CDA I; CDAI; discs lost homolog; DLT; CDA1; PRO1295; |
Gene ID | 146059 |
mRNA Refseq | NM_138477 |
Protein Refseq | NP_612486 |
MIM | 607465 |
UniProt ID | Q8IWY9 |
◆ Recombinant Proteins | ||
CDAN1-0897H | Recombinant Human CDAN1 Protein, GST-Tagged | +Inquiry |
CDAN1-3124M | Recombinant Mouse CDAN1 Protein | +Inquiry |
CDAN1-581R | Recombinant Rhesus Macaque CDAN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cdan1-2070M | Recombinant Mouse Cdan1 Protein, Myc/DDK-tagged | +Inquiry |
CDAN1-3126H | Recombinant Human CDAN1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDAN1 Products
Required fields are marked with *
My Review for All CDAN1 Products
Required fields are marked with *