Recombinant Human CDC123 protein, T7-tagged
Cat.No. : | CDC123-178H |
Product Overview : | Recombinant human CDC123 (336 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 336 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDS DDEAEEIQWSDDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFK SSDFITRDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIR RCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQEQDSP AFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in eIF2 regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping CDC123-Chf-Gcd11 axis protein–protein interaction.4. May be used as antigen for specific antibody development and potential biomarker development for type 2 diabetes diagnosis. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | CDC123 cell division cycle 123 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC123 |
Synonyms | CDC123; cell division cycle 123 homolog (S. cerevisiae); C10orf7, chromosome 10 open reading frame 7; cell division cycle protein 123 homolog; D123; PZ32; HT-1080; C10orf7; FLJ13863; |
Gene ID | 8872 |
mRNA Refseq | NM_006023 |
Protein Refseq | NP_006014 |
MIM | |
UniProt ID | O75794 |
Chromosome Location | 10p13 |
◆ Recombinant Proteins | ||
CDC123-4524H | Recombinant Human CDC123 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDC123-7885H | Recombinant Human CDC123 protein, His & T7-tagged | +Inquiry |
CDC123-3043H | Recombinant Human CDC123, His-tagged | +Inquiry |
CDC123-582R | Recombinant Rhesus Macaque CDC123 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cdc123-712M | Recombinant Mouse Cdc123 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC123-7671HCL | Recombinant Human CDC123 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC123 Products
Required fields are marked with *
My Review for All CDC123 Products
Required fields are marked with *