Recombinant Human CDC123 protein, T7-tagged
| Cat.No. : | CDC123-178H |
| Product Overview : | Recombinant human CDC123 (336 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 336 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFMKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDS DDEAEEIQWSDDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFK SSDFITRDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIR RCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQEQDSP AFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in eIF2 regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping CDC123-Chf-Gcd11 axis protein–protein interaction.4. May be used as antigen for specific antibody development and potential biomarker development for type 2 diabetes diagnosis. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | CDC123 cell division cycle 123 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | CDC123 |
| Synonyms | CDC123; cell division cycle 123 homolog (S. cerevisiae); C10orf7, chromosome 10 open reading frame 7; cell division cycle protein 123 homolog; D123; PZ32; HT-1080; C10orf7; FLJ13863; |
| Gene ID | 8872 |
| mRNA Refseq | NM_006023 |
| Protein Refseq | NP_006014 |
| MIM | |
| UniProt ID | O75794 |
| Chromosome Location | 10p13 |
| ◆ Recombinant Proteins | ||
| CDC123-394C | Recombinant Cynomolgus CDC123 Protein, His-tagged | +Inquiry |
| CDC123-162H | Recombinant Human CDC123 Protein, C-His-tagged | +Inquiry |
| CDC123-927R | Recombinant Rat CDC123 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDC123-442H | Recombinant Human CDC123 Protein, GST-tagged | +Inquiry |
| CDC123-583H | Recombinant Human cell division cycle 123, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDC123-7671HCL | Recombinant Human CDC123 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC123 Products
Required fields are marked with *
My Review for All CDC123 Products
Required fields are marked with *
