Recombinant Human CDC123 protein, T7-tagged

Cat.No. : CDC123-178H
Product Overview : Recombinant human CDC123 (336 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 336 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDS DDEAEEIQWSDDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFK SSDFITRDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIR RCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQEQDSP AFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in eIF2 regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping CDC123-Chf-Gcd11 axis protein–protein interaction.4. May be used as antigen for specific antibody development and potential biomarker development for type 2 diabetes diagnosis.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name CDC123 cell division cycle 123 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol CDC123
Synonyms CDC123; cell division cycle 123 homolog (S. cerevisiae); C10orf7, chromosome 10 open reading frame 7; cell division cycle protein 123 homolog; D123; PZ32; HT-1080; C10orf7; FLJ13863;
Gene ID 8872
mRNA Refseq NM_006023
Protein Refseq NP_006014
MIM
UniProt ID O75794
Chromosome Location 10p13

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC123 Products

Required fields are marked with *

My Review for All CDC123 Products

Required fields are marked with *

0
cart-icon
0
compare icon