Recombinant Human CDC14B Protein, GST-Tagged
Cat.No. : | CDC14B-0900H |
Product Overview : | Human CDC14B full-length ORF (ENSP00000265659, 1 a.a. - 471 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 80.6 kDa |
AA Sequence : | MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTDGWLSQAVTFLDRLLIWLGIHKD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC14B CDC14 cell division cycle 14 homolog B (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC14B |
Synonyms | CDC14B; CDC14 cell division cycle 14 homolog B (S. cerevisiae); CDC14 (cell division cycle 14, S. cerevisiae) homolog B; dual specificity protein phosphatase CDC14B; Cdc14B1; Cdc14B2; CDC14B3; hCDC14B; |
Gene ID | 8555 |
mRNA Refseq | NM_001077181 |
Protein Refseq | NP_001070649 |
MIM | 603505 |
UniProt ID | O60729 |
◆ Recombinant Proteins | ||
CDC14B-1478M | Recombinant Mouse CDC14B Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC14B-3117HF | Recombinant Full Length Human CDC14B Protein, GST-tagged | +Inquiry |
CDC14B-10525Z | Recombinant Zebrafish CDC14B | +Inquiry |
CDC14B-0900H | Recombinant Human CDC14B Protein, GST-Tagged | +Inquiry |
CDC14B-3127M | Recombinant Mouse CDC14B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC14B-318HCL | Recombinant Human CDC14B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC14B Products
Required fields are marked with *
My Review for All CDC14B Products
Required fields are marked with *