Recombinant Human CDC20
Cat.No. : | CDC20-27897TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-100 of Human Cdc20 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle.It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ |
Sequence Similarities : | Belongs to the WD repeat CDC20/Fizzy family.Contains 7 WD repeats. |
Gene Name | CDC20 cell division cycle 20 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC20 |
Synonyms | CDC20; cell division cycle 20 homolog (S. cerevisiae); CDC20 (cell division cycle 20, S. cerevisiae, homolog) , CDC20 cell division cycle 20 homolog (S. cerevisiae); cell division cycle protein 20 homolog; CDC20A; p55CDC; |
Gene ID | 991 |
mRNA Refseq | NM_001255 |
Protein Refseq | NP_001246 |
MIM | 603618 |
Uniprot ID | Q12834 |
Chromosome Location | 1p34.1 |
Pathway | APC/C complex, organism-specific biosystem; APC/C complex, conserved biosystem; APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Cyclin B, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; |
Function | enzyme binding; protein C-terminus binding; protein binding; |
◆ Recombinant Proteins | ||
CDC20-758R | Recombinant Rhesus monkey CDC20 Protein, His-tagged | +Inquiry |
CDC20-584R | Recombinant Rhesus Macaque CDC20 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC20-1042HFL | Recombinant Full Length Human CDC20 Protein, C-Flag-tagged | +Inquiry |
CDC20-27897TH | Recombinant Human CDC20 | +Inquiry |
CDC20-1270R | Recombinant Rat CDC20 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC20-7668HCL | Recombinant Human CDC20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC20 Products
Required fields are marked with *
My Review for All CDC20 Products
Required fields are marked with *