Recombinant Human CDC25C protein, His-tagged
| Cat.No. : | CDC25C-2676H |
| Product Overview : | Recombinant Human CDC25C protein(P30307)(1-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-473aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 57.4 kDa |
| AA Sequence : | MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CDC25C cell division cycle 25 homolog C (S. pombe) [ Homo sapiens ] |
| Official Symbol | CDC25C |
| Synonyms | CDC25C; cell division cycle 25 homolog C (S. pombe); CDC25, cell division cycle 25 homolog C (S. cerevisiae) , cell division cycle 25C; M-phase inducer phosphatase 3; PPP1R60; protein phosphatase 1; regulatory subunit 60; mitosis inducer CDC25; cell division cycle 25C; phosphotyrosine phosphatase; dual specificity phosphatase CDC25C; protein phosphatase 1, regulatory subunit 60; CDC25; |
| Gene ID | 995 |
| mRNA Refseq | NM_001790 |
| Protein Refseq | NP_001781 |
| MIM | 157680 |
| UniProt ID | P30307 |
| ◆ Recombinant Proteins | ||
| CDC25C-1513H | Active Recombinant Human CDC25C, GST-tagged | +Inquiry |
| CDC25C-11001H | Recombinant Human CDC25C, His-tagged | +Inquiry |
| CDC25C-1480M | Recombinant Mouse CDC25C Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDC25C-3054HF | Recombinant Full Length Human CDC25C Protein, GST-tagged | +Inquiry |
| CDC25C-0918H | Recombinant Human CDC25C Protein, GST-Tagged | +Inquiry |
| ◆ Native Proteins | ||
| Cdc25c-11M | Recombinant Full Length Mouse Cdc25c Protein, Flag tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDC25C-099HKCL | Human CDC25C Knockdown Cell Lysate | +Inquiry |
| CDC25C-7664HCL | Recombinant Human CDC25C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC25C Products
Required fields are marked with *
My Review for All CDC25C Products
Required fields are marked with *
