Recombinant Human CDC27 protein, His-tagged

Cat.No. : CDC27-3589H
Product Overview : Recombinant Human CDC27 protein(481-830 aa), fused to His tag, was expressed in E. coli.
Availability November 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 481-830 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CDC27 cell division cycle 27 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol CDC27
Synonyms CDC27; cell division cycle 27 homolog (S. cerevisiae); cell division cycle 27 , D17S978E, D0S1430E; cell division cycle protein 27 homolog; ANAPC3; anaphase promoting complex subunit 3; APC3; NUC2; H-NUC; nuc2 homolog; CDC27 homolog; anaphase-promoting complex subunit 3; anaphase-promoting complex, protein 3; HNUC; CDC27Hs; D0S1430E; D17S978E;
Gene ID 996
mRNA Refseq NM_001114091
Protein Refseq NP_001107563
MIM 116946
UniProt ID P30260

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC27 Products

Required fields are marked with *

My Review for All CDC27 Products

Required fields are marked with *

0
cart-icon
0
compare icon