Recombinant Human CDC27 protein, His-tagged

• Cat.No.: CDC27-3589H
• Product Overview: Recombinant Human CDC27 protein(481-830 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 481-830 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CDC27 cell division cycle 27 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: CDC27
• Synonyms: CDC27; cell division cycle 27 homolog (S. cerevisiae); cell division cycle 27 , D17S978E, D0S1430E; cell division cycle protein 27 homolog; ANAPC3; anaphase promoting complex subunit 3; APC3; NUC2; H-NUC; nuc2 homolog; CDC27 homolog; anaphase-promoting complex subunit 3; anaphase-promoting complex, protein 3; HNUC; CDC27Hs; D0S1430E; D17S978E
• Gene ID: 996
• mRNA Refseq: NM_001114091
• Protein Refseq: NP_001107563
• MIM: 116946
• UniProt ID: P30260