Recombinant Human CDC27 protein, His-tagged
| Cat.No. : | CDC27-3589H |
| Product Overview : | Recombinant Human CDC27 protein(481-830 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 481-830 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CDC27 cell division cycle 27 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | CDC27 |
| Synonyms | CDC27; cell division cycle 27 homolog (S. cerevisiae); cell division cycle 27 , D17S978E, D0S1430E; cell division cycle protein 27 homolog; ANAPC3; anaphase promoting complex subunit 3; APC3; NUC2; H-NUC; nuc2 homolog; CDC27 homolog; anaphase-promoting complex subunit 3; anaphase-promoting complex, protein 3; HNUC; CDC27Hs; D0S1430E; D17S978E; |
| Gene ID | 996 |
| mRNA Refseq | NM_001114091 |
| Protein Refseq | NP_001107563 |
| MIM | 116946 |
| UniProt ID | P30260 |
| ◆ Recombinant Proteins | ||
| CDC27-3071HF | Recombinant Full Length Human CDC27 Protein, GST-tagged | +Inquiry |
| CDC27-0704H | Recombinant Human CDC27 Protein (Asn17-Ser231), N-His tagged | +Inquiry |
| CDC27-3135M | Recombinant Mouse CDC27 Protein | +Inquiry |
| CDC27-1271H | Recombinant Human CDC27 protein, His & T7-tagged | +Inquiry |
| CDC27-11003H | Recombinant Human CDC27, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDC27-7662HCL | Recombinant Human CDC27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC27 Products
Required fields are marked with *
My Review for All CDC27 Products
Required fields are marked with *
