Recombinant Human CDC37 protein, T7/His-tagged
| Cat.No. : | CDC37-124H |
| Product Overview : | Recombinant human CDC37 (377aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEK EELDRGCRECKRKVAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKD GFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDL EVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIE KAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSK ASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | CDC37 cell division cycle 37 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | CDC37 |
| Synonyms | CDC37; cell division cycle 37 homolog (S. cerevisiae); CDC37 (cell division cycle 37, S. cerevisiae, homolog) , CDC37 cell division cycle 37 homolog (S. cerevisiae); hsp90 co-chaperone Cdc37; CDC37 (cell division cycle 37; S. cerevisiae; homolog); CDC37 cell division cycle 37 homolog; Hsp90 co chaperone Cdc37; P50CDC37; hsp90 chaperone protein kinase-targeting subunit; CDC37 (cell division cycle 37, S. cerevisiae, homolog); |
| Gene ID | 11140 |
| mRNA Refseq | NM_007065 |
| Protein Refseq | NP_008996 |
| MIM | 605065 |
| UniProt ID | Q16543 |
| Chromosome Location | 19p13.2 |
| Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; Disease, organism-specific biosystem; LKB1 signaling events, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by EGFR in Cancer, organism-specific biosystem; Signaling by ERBB2, organism-specific biosystem; Signaling by constitutively active EGFR, organism-specific biosystem; |
| Function | Hsp90 protein binding; heat shock protein binding; protein binding; protein kinase binding; unfolded protein binding; |
| ◆ Recombinant Proteins | ||
| CDC37-26223TH | Recombinant Human CDC37 | +Inquiry |
| CDC37-3072H | Recombinant Human CDC37 protein(Met1-Val378), GST-tagged | +Inquiry |
| CDC37-3124H | Recombinant Human CDC37 Protein, MYC/DDK-tagged | +Inquiry |
| Cdc37-855M | Recombinant Mouse Cdc37 Protein, MYC/DDK-tagged | +Inquiry |
| CDC37-3073HF | Recombinant Full Length Human CDC37 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDC37-001MCL | Recombinant Mouse CDC37 cell lysate | +Inquiry |
| CDC37-648HCL | Recombinant Human CDC37 cell lysate | +Inquiry |
| CDC37-100HKCL | Human CDC37 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC37 Products
Required fields are marked with *
My Review for All CDC37 Products
Required fields are marked with *
