Recombinant Human CDC42BPB Protein, GST-Tagged
| Cat.No. : | CDC42BPB-0941H |
| Product Overview : | Human CDC42BPB partial ORF (AAD37506, 1580 a.a. - 1679 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the serine/threonine protein kinase family. The encoded protein contains a Cdc42/Rac-binding p21 binding domain resembling that of PAK kinase. The kinase domain of this protein is most closely related to that of myotonic dystrophy kinase-related ROK. Studies of the similar gene in rat suggested that this kinase may act as a downstream effector of Cdc42 in cytoskeletal reorganization. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDC42BPB CDC42 binding protein kinase beta (DMPK-like) [ Homo sapiens ] |
| Official Symbol | CDC42BPB |
| Synonyms | CDC42BPB; CDC42 binding protein kinase beta (DMPK-like); CDC42 binding protein kinase beta (DMPK like); serine/threonine-protein kinase MRCK beta; KIAA1124; MRCKB; MRCK beta; CDC42BP-beta; DMPK-like beta; myotonic dystrophy protein kinase-like beta; CDC42-binding protein kinase beta (DMPK-like); myotonic dystrophy kinase-related CDC42-binding kinase beta; FLJ37601; FLJ44730; DKFZp686H1431; |
| Gene ID | 9578 |
| mRNA Refseq | NM_006035 |
| Protein Refseq | NP_006026 |
| MIM | 614062 |
| UniProt ID | Q9Y5S2 |
| ◆ Recombinant Proteins | ||
| CDC42BPB-358H | Recombinant Human CDC42BPB, GST-tagged, Active | +Inquiry |
| CDC42BPB-0940H | Active Recombinant Human CDC42BPB Protein, GST-Tagged | +Inquiry |
| CDC42BPB-1485M | Recombinant Mouse CDC42BPB Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDC42BPB-937R | Recombinant Rat CDC42BPB Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDC42BPB-2501H | Recombinant Human CDC42BPB protein(Met1-His427), His&GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDC42BPB-569HCL | Recombinant Human CDC42BPB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC42BPB Products
Required fields are marked with *
My Review for All CDC42BPB Products
Required fields are marked with *



