Recombinant Human CDC42BPB Protein, GST-Tagged

Cat.No. : CDC42BPB-0941H
Product Overview : Human CDC42BPB partial ORF (AAD37506, 1580 a.a. - 1679 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the serine/threonine protein kinase family. The encoded protein contains a Cdc42/Rac-binding p21 binding domain resembling that of PAK kinase. The kinase domain of this protein is most closely related to that of myotonic dystrophy kinase-related ROK. Studies of the similar gene in rat suggested that this kinase may act as a downstream effector of Cdc42 in cytoskeletal reorganization. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDC42BPB CDC42 binding protein kinase beta (DMPK-like) [ Homo sapiens ]
Official Symbol CDC42BPB
Synonyms CDC42BPB; CDC42 binding protein kinase beta (DMPK-like); CDC42 binding protein kinase beta (DMPK like); serine/threonine-protein kinase MRCK beta; KIAA1124; MRCKB; MRCK beta; CDC42BP-beta; DMPK-like beta; myotonic dystrophy protein kinase-like beta; CDC42-binding protein kinase beta (DMPK-like); myotonic dystrophy kinase-related CDC42-binding kinase beta; FLJ37601; FLJ44730; DKFZp686H1431;
Gene ID 9578
mRNA Refseq NM_006035
Protein Refseq NP_006026
MIM 614062
UniProt ID Q9Y5S2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC42BPB Products

Required fields are marked with *

My Review for All CDC42BPB Products

Required fields are marked with *

0
cart-icon