Recombinant Human CDC42BPB Protein, GST-Tagged

• Cat.No.: CDC42BPB-0941H
• Product Overview: Human CDC42BPB partial ORF (AAD37506, 1580 a.a. - 1679 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the serine/threonine protein kinase family. The encoded protein contains a Cdc42/Rac-binding p21 binding domain resembling that of PAK kinase. The kinase domain of this protein is most closely related to that of myotonic dystrophy kinase-related ROK. Studies of the similar gene in rat suggested that this kinase may act as a downstream effector of Cdc42 in cytoskeletal reorganization. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.63 kDa
• AA Sequence: SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDC42BPB CDC42 binding protein kinase beta (DMPK-like) [ Homo sapiens ]
• Official Symbol: CDC42BPB
• Synonyms: CDC42BPB; CDC42 binding protein kinase beta (DMPK-like); CDC42 binding protein kinase beta (DMPK like); serine/threonine-protein kinase MRCK beta; KIAA1124; MRCKB; MRCK beta; CDC42BP-beta; DMPK-like beta; myotonic dystrophy protein kinase-like beta; CDC42-binding protein kinase beta (DMPK-like); myotonic dystrophy kinase-related CDC42-binding kinase beta; FLJ37601; FLJ44730; DKFZp686H1431
• Gene ID: 9578
• mRNA Refseq: NM_006035
• Protein Refseq: NP_006026
• MIM: 614062
• UniProt ID: Q9Y5S2