Recombinant Human CDC42EP1 protein, His-tagged
Cat.No. : | CDC42EP1-3158H |
Product Overview : | Recombinant Human CDC42EP1 protein, fused to His tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CDC42EP1 CDC42 effector protein (Rho GTPase binding) 1 [ Homo sapiens ] |
Official Symbol | CDC42EP1 |
Synonyms | CDC42EP1; CDC42 effector protein (Rho GTPase binding) 1; cdc42 effector protein 1; 55 kDa bone marrow stromal/endothelial cell protein; Borg5; CEP1; MSE55; serum constituent protein; serum protein MSE55; binder of Rho GTPases 5; BORG5; MGC15316; |
Gene ID | 11135 |
mRNA Refseq | NM_152243 |
Protein Refseq | NP_689449 |
MIM | 606084 |
UniProt ID | Q00587 |
◆ Recombinant Proteins | ||
CDC42EP1-3158H | Recombinant Human CDC42EP1 protein, His-tagged | +Inquiry |
CDC42EP1-3143M | Recombinant Mouse CDC42EP1 Protein | +Inquiry |
CDC42EP1-1487M | Recombinant Mouse CDC42EP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC42EP1-1280R | Recombinant Rat CDC42EP1 Protein | +Inquiry |
CDC42EP1-938R | Recombinant Rat CDC42EP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC42EP1-322HCL | Recombinant Human CDC42EP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC42EP1 Products
Required fields are marked with *
My Review for All CDC42EP1 Products
Required fields are marked with *