Recombinant Human CDC42SE2 Protein, GST-tagged

Cat.No. : CDC42SE2-5176H
Product Overview : Human CDC42SE2 partial ORF ( NP_064625, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CDC42SE2 (CDC42 Small Effector 2) is a Protein Coding gene. Diseases associated with CDC42SE2 include Schizophrenia. GO annotations related to this gene include structural molecule activity. An important paralog of this gene is CDC42SE1.
Molecular Mass : 34.98 kDa
AA Sequence : MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDC42SE2 CDC42 small effector 2 [ Homo sapiens (human) ]
Official Symbol CDC42SE2
Synonyms CDC42SE2; CDC42SE2; CDC42 small effector 2; SPEC2; CDC42 small effector protein 2; non-kinase Cdc42 effector protein SPEC2; small effector of CDC42 protein 2
Gene ID 56990
mRNA Refseq NM_001038702
Protein Refseq NP_001033791
UniProt ID Q9NRR3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC42SE2 Products

Required fields are marked with *

My Review for All CDC42SE2 Products

Required fields are marked with *

0
cart-icon