Recombinant Human CDCA5 Protein, GST-Tagged

Cat.No. : CDCA5-0962H
Product Overview : Human CDCA5 full-length ORF (NP_542399.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CDCA5 (Cell Division Cycle Associated 5) is a Protein Coding gene. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Mitotic Metaphase and Anaphase. GO annotations related to this gene include chromatin binding.
Molecular Mass : 54 kDa
AA Sequence : MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDCA5 cell division cycle associated 5 [ Homo sapiens ]
Official Symbol CDCA5
Synonyms CDCA5; cell division cycle associated 5; sororin; p35; cell division cycle-associated protein 5; SORORIN; MGC16386;
Gene ID 113130
mRNA Refseq NM_080668
Protein Refseq NP_542399
MIM 609374
UniProt ID Q96FF9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDCA5 Products

Required fields are marked with *

My Review for All CDCA5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon