Recombinant Human CDCP2 Protein, GST-Tagged
| Cat.No. : | CDCP2-0968H |
| Product Overview : | Human CDCP2 full-length ORF (1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CDCP2 (CUB Domain Containing Protein 2) is a Protein Coding gene. An important paralog of this gene is CUBN. |
| Molecular Mass : | 43.2 kDa |
| AA Sequence : | MLAEWGACLLLAVALLGPGLQAQAMEGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLIVVAEGSSVLLTFHAFDLEYHDTCSFDFLEIYNGASPDKGNLLGRFCGKVPPPPFTSSWHVMSVIFHSDKHVASHGFSAGYQKGQRGALGTCCSGSHL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDCP2 CUB domain containing protein 2 [ Homo sapiens ] |
| Official Symbol | CDCP2 |
| Synonyms | CDCP2; CUB domain containing protein 2; CUB domain-containing protein 2; |
| Gene ID | 200008 |
| mRNA Refseq | NM_201546 |
| Protein Refseq | NP_963840 |
| MIM | 612320 |
| UniProt ID | Q5VXM1 |
| ◆ Recombinant Proteins | ||
| CDCP2-0968H | Recombinant Human CDCP2 Protein, GST-Tagged | +Inquiry |
| CDCP2-3124HF | Recombinant Full Length Human CDCP2 Protein, GST-tagged | +Inquiry |
| CDCP2-3161M | Recombinant Mouse CDCP2 Protein | +Inquiry |
| CDCP2-917H | Recombinant Human CDCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CDCP2-3119H | Recombinant Human CDCP2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDCP2 Products
Required fields are marked with *
My Review for All CDCP2 Products
Required fields are marked with *
