Recombinant Human CDCP2 Protein, GST-Tagged
Cat.No. : | CDCP2-0968H |
Product Overview : | Human CDCP2 full-length ORF (1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CDCP2 (CUB Domain Containing Protein 2) is a Protein Coding gene. An important paralog of this gene is CUBN. |
Molecular Mass : | 43.2 kDa |
AA Sequence : | MLAEWGACLLLAVALLGPGLQAQAMEGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLIVVAEGSSVLLTFHAFDLEYHDTCSFDFLEIYNGASPDKGNLLGRFCGKVPPPPFTSSWHVMSVIFHSDKHVASHGFSAGYQKGQRGALGTCCSGSHL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDCP2 CUB domain containing protein 2 [ Homo sapiens ] |
Official Symbol | CDCP2 |
Synonyms | CDCP2; CUB domain containing protein 2; CUB domain-containing protein 2; |
Gene ID | 200008 |
mRNA Refseq | NM_201546 |
Protein Refseq | NP_963840 |
MIM | 612320 |
UniProt ID | Q5VXM1 |
◆ Recombinant Proteins | ||
CDCP2-3124HF | Recombinant Full Length Human CDCP2 Protein, GST-tagged | +Inquiry |
CDCP2-0968H | Recombinant Human CDCP2 Protein, GST-Tagged | +Inquiry |
Cdcp2-2080M | Recombinant Mouse Cdcp2 Protein, Myc/DDK-tagged | +Inquiry |
CDCP2-917H | Recombinant Human CDCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDCP2-1500M | Recombinant Mouse CDCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDCP2 Products
Required fields are marked with *
My Review for All CDCP2 Products
Required fields are marked with *