Recombinant Human CDH11 Protein, GST-Tagged
Cat.No. : | CDH11-0972H |
Product Overview : | Human CDH11 partial ORF (NP_001788, 509 a.a. - 617 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Expression of this particular cadherin in osteoblastic cell lines, and its upregulation during differentiation, suggests a specific function in bone development and maintenance. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDH11 cadherin 11, type 2, OB-cadherin (osteoblast) [ Homo sapiens ] |
Official Symbol | CDH11 |
Synonyms | CDH11; cadherin 11, type 2, OB-cadherin (osteoblast); cadherin-11; CAD11; OB; OB Cadherin; CDHOB; OSF-4; |
Gene ID | 1009 |
mRNA Refseq | NM_001797 |
Protein Refseq | NP_001788 |
MIM | 600023 |
UniProt ID | P55287 |
◆ Recombinant Proteins | ||
CDH11-1190C | Recombinant Chicken CDH11 | +Inquiry |
CDH11-1331H | Recombinant Human CDH11 Protein (Phe23-Thr617), C-His tagged | +Inquiry |
CDH11-600R | Recombinant Rhesus Macaque CDH11 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH11-3979H | Recombinant Human CDH11, His tagged | +Inquiry |
CDH11-8815Z | Recombinant Zebrafish CDH11 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH11-7638HCL | Recombinant Human CDH11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH11 Products
Required fields are marked with *
My Review for All CDH11 Products
Required fields are marked with *