Recombinant Human CDH15 protein, T7/His-tagged

Cat.No. : CDH15-50H
Product Overview : Recombinant human CDH15 (61– 246aa, derived from BC008951) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 61-246 a.a.
Form : 2.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFLPYPLVQIKSDKQQLGSVIYSIQGPGVDEEPRGVFSIDKFTGKVFL NAMLDREKTDRFRLRAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDADD PETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAWAHNSRNLVA AALRVVAVAVVVAAVAN
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro CDH15 N-termianl mediated myogenesis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CDH15 N-terminal Cadherin domain protein-protein interaction assay.3. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name CDH15 cadherin 15, type 1, M-cadherin (myotubule) [ Homo sapiens ]
Official Symbol CDH15
Synonyms CDH15; cadherin 15, type 1, M-cadherin (myotubule); cadherin 15, M cadherin (myotubule) , CDH3, CDH14; cadherin-15; cadherin-3; cadherin-14; muscle-cadherin; CDH3; CDHM; MCAD; MRD3; CDH14;
Gene ID 1013
mRNA Refseq NM_004933
Protein Refseq NP_004924
MIM 114019
UniProt ID P55291
Chromosome Location 16q24.3
Pathway Adherens junctions interactions, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDH15 Products

Required fields are marked with *

My Review for All CDH15 Products

Required fields are marked with *

0
cart-icon