Recombinant Human CDH17

Cat.No. : CDH17-29102TH
Product Overview : Recombinant fragment (amino acids 24-131) of Human LI Cadherin with proprietary tag at the N terminal; Predicted MW 37.51 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 108 amino acids
Description : This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants.
Molecular Weight : 37.510kDa inclusive of tags
Tissue specificity : Expressed in the gastrointestinal tract and pancreatic duct. Not detected in kidney, lung, liver, brain, adrenal gland and skin.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELT GETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANG IIVEGPVPITIEVKDINDNRPTFLQSKY
Sequence Similarities : Contains 7 cadherin domains.
Gene Name CDH17 cadherin 17, LI cadherin (liver-intestine) [ Homo sapiens ]
Official Symbol CDH17
Synonyms CDH17; cadherin 17, LI cadherin (liver-intestine); cadherin-17; cadherin; HPT 1;
Gene ID 1015
mRNA Refseq NM_001144663
Protein Refseq NP_001138135
MIM 603017
Uniprot ID Q12864
Chromosome Location 8q22.1
Function calcium ion binding; proton-dependent oligopeptide secondary active transmembrane transporter activity; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDH17 Products

Required fields are marked with *

My Review for All CDH17 Products

Required fields are marked with *

0
cart-icon