Recombinant Human CDH17
Cat.No. : | CDH17-29102TH |
Product Overview : | Recombinant fragment (amino acids 24-131) of Human LI Cadherin with proprietary tag at the N terminal; Predicted MW 37.51 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 108 amino acids |
Description : | This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. |
Molecular Weight : | 37.510kDa inclusive of tags |
Tissue specificity : | Expressed in the gastrointestinal tract and pancreatic duct. Not detected in kidney, lung, liver, brain, adrenal gland and skin. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELT GETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANG IIVEGPVPITIEVKDINDNRPTFLQSKY |
Sequence Similarities : | Contains 7 cadherin domains. |
Gene Name | CDH17 cadherin 17, LI cadherin (liver-intestine) [ Homo sapiens ] |
Official Symbol | CDH17 |
Synonyms | CDH17; cadherin 17, LI cadherin (liver-intestine); cadherin-17; cadherin; HPT 1; |
Gene ID | 1015 |
mRNA Refseq | NM_001144663 |
Protein Refseq | NP_001138135 |
MIM | 603017 |
Uniprot ID | Q12864 |
Chromosome Location | 8q22.1 |
Function | calcium ion binding; proton-dependent oligopeptide secondary active transmembrane transporter activity; transporter activity; |
◆ Recombinant Proteins | ||
CDH17-1411R | Recombinant Rhesus macaque CDH17 protein, His-tagged | +Inquiry |
CDH17-1528H | Recombinant Human CDH17 protein, His-tagged | +Inquiry |
CDH17-0978H | Recombinant Human CDH17 Protein, GST-Tagged | +Inquiry |
CDH17-1425H | Recombinant Human CDH17 protein, His-tagged, Biotinylated | +Inquiry |
CDH17-2043H | Recombinant Human CDH17 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH17-1483RCL | Recombinant Rat CDH17 cell lysate | +Inquiry |
CDH17-2032HCL | Recombinant Human CDH17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH17 Products
Required fields are marked with *
My Review for All CDH17 Products
Required fields are marked with *