Recombinant Human CDH17 Protein, GST-Tagged
Cat.No. : | CDH17-0978H |
Product Overview : | Human CDH17 partial ORF (NP_004054, 24 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2009] |
Molecular Mass : | 37.62 kDa |
AA Sequence : | EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDH17 cadherin 17, LI cadherin (liver-intestine) [ Homo sapiens ] |
Official Symbol | CDH17 |
Synonyms | CDH17; cadherin 17, LI cadherin (liver-intestine); cadherin-17; cadherin; HPT 1; LI cadherin; LI-cadherin; cadherin-16; HPT-1 cadherin; liver-intestine cadherin; human peptide transporter 1; intestinal peptide-associated transporter HPT-1; human intestinal peptide-associated transporter HPT-1; HPT1; CDH16; HPT-1; FLJ26931; MGC138218; MGC142024; |
Gene ID | 1015 |
mRNA Refseq | NM_001144663 |
Protein Refseq | NP_001138135 |
MIM | 603017 |
UniProt ID | Q12864 |
◆ Recombinant Proteins | ||
CDH17-0978H | Recombinant Human CDH17 Protein, GST-Tagged | +Inquiry |
CDH17-2094H | Recombinant Human CDH17 protein, His & T7-tagged | +Inquiry |
CDH17-1425H | Recombinant Human CDH17 protein, His-tagged, Biotinylated | +Inquiry |
CDH17-1928M | Active Recombinant Mouse CDH17 protein, His-tagged | +Inquiry |
CDH17-1524H | Recombinant Human CDH17 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH17-2032HCL | Recombinant Human CDH17 cell lysate | +Inquiry |
CDH17-1483RCL | Recombinant Rat CDH17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH17 Products
Required fields are marked with *
My Review for All CDH17 Products
Required fields are marked with *
0
Inquiry Basket