Recombinant Human CDH2 Protein, GST-Tagged
| Cat.No. : | CDH2-0984H |
| Product Overview : | Human CDH2 partial ORF (NP_001783, 807 a.a. - 906 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDH2 cadherin 2, type 1, N-cadherin (neuronal) [ Homo sapiens ] |
| Official Symbol | CDH2 |
| Synonyms | CDH2; cadherin 2, type 1, N-cadherin (neuronal); NCAD; cadherin-2; CD325; CDHN; N cadherin; N-cadherin 1; neural cadherin; neural-cadherin; cadherin 2, N-cadherin (neuronal); calcium-dependent adhesion protein, neuronal; CDw325; |
| Gene ID | 1000 |
| mRNA Refseq | NM_001792 |
| Protein Refseq | NP_001783 |
| MIM | 114020 |
| UniProt ID | P19022 |
| ◆ Recombinant Proteins | ||
| RFL13992BF | Recombinant Full Length Bovine Cadherin-2(Cdh2) Protein, His-Tagged | +Inquiry |
| CDH2-001H | Recombinant Human CDH2 Protein, His-tagged | +Inquiry |
| CDH2-1290R | Recombinant Rat CDH2 Protein | +Inquiry |
| CDH2-271H | Recombinant Human CDH2 Protein, His-tagged | +Inquiry |
| Cdh2-8757R | Recombinant Rat Cdh2, His tagged | +Inquiry |
| ◆ Native Proteins | ||
| CDH2-3153H | Recombinant Human CDH2 Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDH2-980HCL | Recombinant Human CDH2 cell lysate | +Inquiry |
| CDH2-971MCL | Recombinant Mouse CDH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH2 Products
Required fields are marked with *
My Review for All CDH2 Products
Required fields are marked with *
