Recombinant Human CDH26 Protein, GST-tagged
Cat.No. : | CDH26-5178H |
Product Overview : | Human CDH26 full-length ORF ( NP_068582.2, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cadherin protein family. Cadherins are a family of calcium-dependent adhesion molecules that mediate cell-cell adhesion in all solid tissues and modulate a wide variety of processes, including cell polarization, migration and differentiation. Cadherin domains occur as repeats in the extracellular region and are thought to contribute to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. This protein is expressed in gastrointestinal epithelial cells and may be upregulated during allergic inflammation. This protein interacts with alpha integrins and may also be involved in leukocyte migration and adhesion. [provided by RefSeq, Jan 2017] |
Molecular Mass : | 44.1 kDa |
AA Sequence : | MKPLIWTWSDVEGQRPALLICTAAAGPTQGVKDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIHSTPAYPDATMHRQLLAPVEGRMAETLNQKLHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSKATPFEEIYSESGVPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDH26 cadherin 26 [ Homo sapiens (human) ] |
Official Symbol | CDH26 |
Synonyms | CDH26; cadherin 26; VR20; cadherin-like protein 26; cadherin-like 26; cadherin-like protein VR20 |
Gene ID | 60437 |
mRNA Refseq | NM_001348204 |
Protein Refseq | NP_001335133 |
MIM | 617685 |
UniProt ID | Q8IXH8 |
◆ Recombinant Proteins | ||
Cdh26-2081M | Recombinant Mouse Cdh26 Protein, Myc/DDK-tagged | +Inquiry |
RFL3122MF | Recombinant Full Length Mouse Cadherin-Like Protein 26(Cdh26) Protein, His-Tagged | +Inquiry |
CDH26-3149H | Recombinant Human CDH26 Protein, MYC/DDK-tagged | +Inquiry |
CDH26-3844HF | Recombinant Full Length Human CDH26 Protein, GST-tagged | +Inquiry |
CDH26-6590H | Recombinant Human CDH26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH26 Products
Required fields are marked with *
My Review for All CDH26 Products
Required fields are marked with *