Recombinant Human CDH3, T7/His-tagged
Cat.No. : | CDH3-281H |
Product Overview : | The full-length extracellular domain of human CDH3 gene (108 - 645 aa) with 29 N-terminal T7/HIS-tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Description : | Cadherin-3, also known as P-Cadherin, is a protein that in humans is encoded by the CDH3 gene. This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein composed of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. This gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in this gene have been associated with congential hypotrichosis with juvenile macular dystrophy. |
Form : | 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSP PEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGV LPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDM DGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSPAWRATYLIMGGDDGDHFT ITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKLPTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGI PTGEPVCVYTAEDPDKENQKISYRILRDPAGWLAMDPDSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNGSPPT TGTGTLLLTLIDVNDHGPVPEPRQITICNQSPVRQVLNITDKDLSPHTSPFQAQLTDDSDIYWTAEVNEEGDTVV LSLKKFLKQDTYDVHLSLSDHGNKEQLTVIRATVCDCHGHVETCPGPWKGG |
Purity : | ≥90% (SDS-PAGE) |
Storage : | Store at −20 centigrade |
Concentration : | 0.5 mg protein/mL |
Gene Name | CDH3 cadherin 3, type 1, P-cadherin (placental) [ Homo sapiens ] |
Official Symbol | CDH3 |
Synonyms | CDHP; HJMD; PCAD; cadherin-3; calcium-dependent adhesion protein, placental |
Gene ID | 1001 |
mRNA Refseq | NM_001793 |
Protein Refseq | NP_001784 |
MIM | 114021 |
UniProt ID | P22223 |
Chromosome Location | 16q22.1 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem |
Function | calcium ion binding; molecular_function |
◆ Recombinant Proteins | ||
CDH3-0809H | Recombinant Human CDH3 Protein (Gly371-Leu660), His tagged | +Inquiry |
CDH3-5818H | Recombinant Human CDH3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDH3-168H | Recombinant Human CDH3, His-tagged | +Inquiry |
CDH3-4101HFL | Recombinant Full Length Human CDH3, Flag-tagged | +Inquiry |
CDH3-281H | Recombinant Human CDH3, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH3-7636HCL | Recombinant Human CDH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH3 Products
Required fields are marked with *
My Review for All CDH3 Products
Required fields are marked with *
0
Inquiry Basket