Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CDH6 protein, GST-tagged

Cat.No. : CDH6-3691H
Product Overview : Recombinant Human CDH6 protein(619 - 665 aa), fused to GST tag, was expressed in E. coli.
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Protein length : 619 - 665 aa
AA Sequence : ILLCIVILLGKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name : CDH6 cadherin 6, type 2, K-cadherin (fetal kidney) [ Homo sapiens ]
Official Symbol : CDH6
Synonyms : CDH6; cadherin 6, type 2, K-cadherin (fetal kidney); cadherin-6; K Cadherin; CAD6; KCAD; FLJ14176; DKFZp564N1116;
Gene ID : 1004
mRNA Refseq : NM_004932
Protein Refseq : NP_004923
MIM : 603007
UniProt ID : P55285

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends