Recombinant Human CDH6 protein, GST-tagged
Cat.No. : | CDH6-3691H |
Product Overview : | Recombinant Human CDH6 protein(619 - 665 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 619 - 665 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | ILLCIVILLGKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CDH6 cadherin 6, type 2, K-cadherin (fetal kidney) [ Homo sapiens ] |
Official Symbol | CDH6 |
Synonyms | CDH6; cadherin 6, type 2, K-cadherin (fetal kidney); cadherin-6; K Cadherin; CAD6; KCAD; FLJ14176; DKFZp564N1116; |
Gene ID | 1004 |
mRNA Refseq | NM_004932 |
Protein Refseq | NP_004923 |
MIM | 603007 |
UniProt ID | P55285 |
◆ Recombinant Proteins | ||
Cdh6-1510M | Recombinant Mouse Cdh6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH6-952R | Recombinant Rat CDH6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH6-3150HF | Recombinant Full Length Human CDH6 Protein, GST-tagged | +Inquiry |
RFL23555MF | Recombinant Full Length Mouse Cadherin-6(Cdh6) Protein, His-Tagged | +Inquiry |
CDH6-1098R | Recombinant Rat CDH6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH6-2727HCL | Recombinant Human CDH6 cell lysate | +Inquiry |
CDH6-1478MCL | Recombinant Mouse CDH6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH6 Products
Required fields are marked with *
My Review for All CDH6 Products
Required fields are marked with *