Recombinant Human CDH6 protein, T7/His-tagged
Cat.No. : | CDH6-110H |
Product Overview : | Recombinant human CDH6 extracellular domain cDNA ( 67 - 615 aa ) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 67-615 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGEFLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAE IEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDAC HKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQ CAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIG KKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro CDH6 human ES cell differentiation and activities" regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for protein-protein interaction assay.3. Potential biomarker protein for clinical monitoring NK cell function in vitro.4. Potential biomarker protein for clinical applications such as monitoring gastric cancer or CML diseases.5. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CDH6 cadherin 6, type 2, K-cadherin (fetal kidney) [ Homo sapiens ] |
Official Symbol | CDH6 |
Synonyms | CDH6; cadherin 6, type 2, K-cadherin (fetal kidney); cadherin-6; K Cadherin; CAD6; KCAD; FLJ14176; DKFZp564N1116; |
Gene ID | 1004 |
mRNA Refseq | NM_004932 |
Protein Refseq | NP_004923 |
MIM | 603007 |
UniProt ID | P55285 |
Chromosome Location | 5p13.3 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
CDH6-952R | Recombinant Rat CDH6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cdh6-593M | Active Recombinant Mouse Cdh6 Protein, His-tagged | +Inquiry |
CDH6-3150HF | Recombinant Full Length Human CDH6 Protein, GST-tagged | +Inquiry |
CDH6-3691H | Recombinant Human CDH6 protein, GST-tagged | +Inquiry |
CDH6-110H | Recombinant Human CDH6 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH6-1478MCL | Recombinant Mouse CDH6 cell lysate | +Inquiry |
CDH6-2727HCL | Recombinant Human CDH6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH6 Products
Required fields are marked with *
My Review for All CDH6 Products
Required fields are marked with *
0
Inquiry Basket