Recombinant Human CDH6 protein, T7/His-tagged

Cat.No. : CDH6-110H
Product Overview : Recombinant human CDH6 extracellular domain cDNA ( 67 - 615 aa ) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 67-615 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGEFLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAE IEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDAC HKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQ CAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIG KKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro CDH6 human ES cell differentiation and activities" regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for protein-protein interaction assay.3. Potential biomarker protein for clinical monitoring NK cell function in vitro.4. Potential biomarker protein for clinical applications such as monitoring gastric cancer or CML diseases.5. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name CDH6 cadherin 6, type 2, K-cadherin (fetal kidney) [ Homo sapiens ]
Official Symbol CDH6
Synonyms CDH6; cadherin 6, type 2, K-cadherin (fetal kidney); cadherin-6; K Cadherin; CAD6; KCAD; FLJ14176; DKFZp564N1116;
Gene ID 1004
mRNA Refseq NM_004932
Protein Refseq NP_004923
MIM 603007
UniProt ID P55285
Chromosome Location 5p13.3
Pathway Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDH6 Products

Required fields are marked with *

My Review for All CDH6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon