Recombinant Human CDH8

Cat.No. : CDH8-26742TH
Product Overview : Recombinant fragment (amino acids 522-621) of Human Cadherin 8 with proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the proteins homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is expressed in brain and is putatively involved in synaptic adhesion, axon outgrowth and guidance.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Mainly expressed in brain. Found in certain nerve cell lines, such as retinoblasts, glioma cells and neuroblasts.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSM
Sequence Similarities : Contains 5 cadherin domains.
Gene Name CDH8 cadherin 8, type 2 [ Homo sapiens ]
Official Symbol CDH8
Synonyms CDH8; cadherin 8, type 2; cadherin-8;
Gene ID 1006
mRNA Refseq NM_001796
Protein Refseq NP_001787
MIM 603008
Uniprot ID P55286
Chromosome Location 16q22.1
Pathway Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDH8 Products

Required fields are marked with *

My Review for All CDH8 Products

Required fields are marked with *

0
cart-icon