Recombinant Human CDH8

• Cat.No.: CDH8-26742TH
• Product Overview: Recombinant fragment (amino acids 522-621) of Human Cadherin 8 with proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the proteins homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is expressed in brain and is putatively involved in synaptic adhesion, axon outgrowth and guidance.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Mainly expressed in brain. Found in certain nerve cell lines, such as retinoblasts, glioma cells and neuroblasts.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSM
• Sequence Similarities: Contains 5 cadherin domains.

Gene Information

• Gene Name: CDH8 cadherin 8, type 2 [ Homo sapiens ]
• Official Symbol: CDH8
• Synonyms: CDH8; cadherin 8, type 2; cadherin-8
• Gene ID: 1006
• mRNA Refseq: NM_001796
• Protein Refseq: NP_001787
• MIM: 603008
• Uniprot ID: P55286
• Chromosome Location: 16q22.1
• Pathway: Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem
• Function: calcium ion binding