Recombinant Human CDH8
Cat.No. : | CDH8-26742TH |
Product Overview : | Recombinant fragment (amino acids 522-621) of Human Cadherin 8 with proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the proteins homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is expressed in brain and is putatively involved in synaptic adhesion, axon outgrowth and guidance. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Mainly expressed in brain. Found in certain nerve cell lines, such as retinoblasts, glioma cells and neuroblasts. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSM |
Sequence Similarities : | Contains 5 cadherin domains. |
Gene Name | CDH8 cadherin 8, type 2 [ Homo sapiens ] |
Official Symbol | CDH8 |
Synonyms | CDH8; cadherin 8, type 2; cadherin-8; |
Gene ID | 1006 |
mRNA Refseq | NM_001796 |
Protein Refseq | NP_001787 |
MIM | 603008 |
Uniprot ID | P55286 |
Chromosome Location | 16q22.1 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
CDH8-625H | Recombinant Human CDH8 | +Inquiry |
Cdh8-24R | Recombinant Rat Cdh8, LEVLFQ tagged | +Inquiry |
Cdh8-8760R | Recombinant Rat Cdh8, His tagged | +Inquiry |
CDH8-0995H | Recombinant Human CDH8 Protein, GST-Tagged | +Inquiry |
CDH8-3152HF | Recombinant Full Length Human CDH8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH8-2738HCL | Recombinant Human CDH8 cell lysate | +Inquiry |
CDH8-991RCL | Recombinant Rat CDH8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH8 Products
Required fields are marked with *
My Review for All CDH8 Products
Required fields are marked with *
0
Inquiry Basket