Recombinant Human CDHR3 Protein, GST-tagged
| Cat.No. : | CDHR3-4290H |
| Product Overview : | Human FLJ23834 partial ORF ( NP_689963, 776 a.a. - 885 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CDHR3 (Cadherin Related Family Member 3) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CDHR4. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | IFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDHR3 cadherin related family member 3 [ Homo sapiens (human) ] |
| Official Symbol | CDHR3 |
| Synonyms | CDHR3; cadherin related family member 3; CDH28; cadherin-related family member 3; cadherin-like protein 28 |
| Gene ID | 222256 |
| mRNA Refseq | NM_001301161 |
| Protein Refseq | NP_001288090 |
| MIM | 615610 |
| UniProt ID | Q6ZTQ4 |
| ◆ Recombinant Proteins | ||
| CDHR3-1513M | Recombinant Mouse CDHR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDHR3-3186M | Recombinant Mouse CDHR3 Protein | +Inquiry |
| CDHR3-4290H | Recombinant Human CDHR3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDHR3 Products
Required fields are marked with *
My Review for All CDHR3 Products
Required fields are marked with *
