Recombinant Human CDHR3 Protein, GST-tagged

• Cat.No.: CDHR3-4290H
• Product Overview: Human FLJ23834 partial ORF ( NP_689963, 776 a.a. - 885 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CDHR3 (Cadherin Related Family Member 3) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CDHR4.
• Molecular Mass: 37.84 kDa
• AA Sequence: IFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDHR3 cadherin related family member 3 [ Homo sapiens (human) ]
• Official Symbol: CDHR3
• Synonyms: CDHR3; cadherin related family member 3; CDH28; cadherin-related family member 3; cadherin-like protein 28
• Gene ID: 222256
• mRNA Refseq: NM_001301161
• Protein Refseq: NP_001288090
• MIM: 615610
• UniProt ID: Q6ZTQ4