Recombinant Human CDHR3 Protein, GST-tagged

Cat.No. : CDHR3-4290H
Product Overview : Human FLJ23834 partial ORF ( NP_689963, 776 a.a. - 885 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CDHR3 (Cadherin Related Family Member 3) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CDHR4.
Molecular Mass : 37.84 kDa
AA Sequence : IFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDHR3 cadherin related family member 3 [ Homo sapiens (human) ]
Official Symbol CDHR3
Synonyms CDHR3; cadherin related family member 3; CDH28; cadherin-related family member 3; cadherin-like protein 28
Gene ID 222256
mRNA Refseq NM_001301161
Protein Refseq NP_001288090
MIM 615610
UniProt ID Q6ZTQ4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDHR3 Products

Required fields are marked with *

My Review for All CDHR3 Products

Required fields are marked with *

0
cart-icon