Recombinant Human CDHR4 Protein
Cat.No. : | CDHR4-5256H |
Product Overview : | Human CDHR4 full-length ORF (ADR82858.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | CDHR4 (Cadherin Related Family Member 4) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CDHR3. |
Form : | Liquid |
Molecular Mass : | 21.9 kDa |
AA Sequence : | MVLLRLLVFLFAPVVSDLCSLPCFINVSESQGPGTVLQFLSFNCSSYTPTPTLELLNVQPPTTFFNPPSLARWQGTYVGKLTLSSSAQLDALMVNHYKVQLKFTCGNHVMEGSLSVDVQRDLSHIQCAGQFASPGEARGSRQGGGRHGLSRSSLTSTLASWGNDSGARDSHTWGSAVHSAPPRPRTPRSAGKPRTWDGG |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CDHR4 cadherin related family member 4 [ Homo sapiens (human) ] |
Official Symbol | CDHR4 |
Synonyms | CDHR4; cadherin related family member 4; CDH29; PRO34300; cadherin-related family member 4; Cadherin-like protein UNQ9392/PRO34300; VLLR9392; cadherin-like 29; cadherin-like protein 29 |
Gene ID | 389118 |
mRNA Refseq | NM_001007540 |
Protein Refseq | NP_001007541 |
UniProt ID | A6H8M9 |
◆ Recombinant Proteins | ||
CDHR4-5256H | Recombinant Human CDHR4 Protein | +Inquiry |
RFL1987HF | Recombinant Full Length Human Cadherin-Related Family Member 4(Cdhr4) Protein, His-Tagged | +Inquiry |
CDHR4-3915HF | Recombinant Full Length Human CDHR4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDHR4 Products
Required fields are marked with *
My Review for All CDHR4 Products
Required fields are marked with *