Recombinant Human CDHR5 Protein, GST-tagged

Cat.No. : CDHR5-5752H
Product Overview : Human MUCDHL partial ORF ( NP_068743, 27 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a novel mucin-like gene that is a member of the cadherin superfamily. While encoding nonpolymorphic tandem repeats rich in proline, serine and threonine similar to mucin proteins, the gene also contains sequence encoding calcium-binding motifs found in all cadherins. The role of the hybrid extracellular region and the specific function of this protein have not yet been determined. Alternative splicing has been identified, with observed variation resulting in the presence or absence of domains. In addition, splicing occurs in the 5 UTR but transcripts including these variations have not been described completely. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : AQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDHR5 cadherin related family member 5 [ Homo sapiens (human) ]
Official Symbol CDHR5
Synonyms CDHR5; cadherin related family member 5; MLPCDH; MUCDHL; MUPCDH; MU-PCDH; cadherin-related family member 5; differentiation-associated catenin regulator; mu-protocadherin; mucin and cadherin-like protein
Gene ID 53841
mRNA Refseq NM_001171968
Protein Refseq NP_001165439
MIM 606839
UniProt ID Q9HBB8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDHR5 Products

Required fields are marked with *

My Review for All CDHR5 Products

Required fields are marked with *

0
cart-icon