Recombinant Human CDHR5 Protein, GST-tagged
Cat.No. : | CDHR5-5752H |
Product Overview : | Human MUCDHL partial ORF ( NP_068743, 27 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a novel mucin-like gene that is a member of the cadherin superfamily. While encoding nonpolymorphic tandem repeats rich in proline, serine and threonine similar to mucin proteins, the gene also contains sequence encoding calcium-binding motifs found in all cadherins. The role of the hybrid extracellular region and the specific function of this protein have not yet been determined. Alternative splicing has been identified, with observed variation resulting in the presence or absence of domains. In addition, splicing occurs in the 5 UTR but transcripts including these variations have not been described completely. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | AQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDHR5 cadherin related family member 5 [ Homo sapiens (human) ] |
Official Symbol | CDHR5 |
Synonyms | CDHR5; cadherin related family member 5; MLPCDH; MUCDHL; MUPCDH; MU-PCDH; cadherin-related family member 5; differentiation-associated catenin regulator; mu-protocadherin; mucin and cadherin-like protein |
Gene ID | 53841 |
mRNA Refseq | NM_001171968 |
Protein Refseq | NP_001165439 |
MIM | 606839 |
UniProt ID | Q9HBB8 |
◆ Recombinant Proteins | ||
CDHR5-5752H | Recombinant Human CDHR5 Protein, GST-tagged | +Inquiry |
Cdhr5-2083M | Recombinant Mouse Cdhr5 Protein, Myc/DDK-tagged | +Inquiry |
CDHR5-066H | Recombinant Human CDHR5 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDHR5-560H | Recombinant Human CDHR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDHR5-1525HFL | Recombinant Full Length Human CDHR5 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDHR5 Products
Required fields are marked with *
My Review for All CDHR5 Products
Required fields are marked with *
0
Inquiry Basket