Recombinant Human CDIPT Protein, GST-Tagged
Cat.No. : | CDIPT-0998H |
Product Overview : | Human CDIPT full-length ORF (AAH01444, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Phosphatidylinositol breakdown products are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. Two enzymes, CDP-diacylglycerol synthase and phosphatidylinositol synthase, are involved in the biosynthesis of phosphatidylinositol. Phosphatidylinositol synthase, a member of the CDP-alcohol phosphatidyl transferase class-I family, is an integral membrane protein found on the cytoplasmic side of the endoplasmic reticulum and the Golgi apparatus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013] |
Molecular Mass : | 49.17 kDa |
AA Sequence : | MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDIPT CDP-diacylglycerol--inositol 3-phosphatidyltransferase [ Homo sapiens ] |
Official Symbol | CDIPT |
Synonyms | CDIPT; CDP-diacylglycerol--inositol 3-phosphatidyltransferase; CDP diacylglycerol inositol 3 phosphatidyltransferase (phosphatidylinositol synthase); phosphatidylinositol synthase; PIS; PIS1; PI synthase; PtdIns synthase; MGC1328; |
Gene ID | 10423 |
mRNA Refseq | NM_006319 |
Protein Refseq | NP_006310 |
MIM | 605893 |
UniProt ID | O14735 |
◆ Recombinant Proteins | ||
CDIPT-0998H | Recombinant Human CDIPT Protein, GST-Tagged | +Inquiry |
RFL14762MF | Recombinant Full Length Mouse Cdp-Diacylglycerol--Inositol 3-Phosphatidyltransferase(Cdipt) Protein, His-Tagged | +Inquiry |
CDIPT-3153HF | Recombinant Full Length Human CDIPT Protein, GST-tagged | +Inquiry |
CDIPT-1514M | Recombinant Mouse CDIPT Protein, His (Fc)-Avi-tagged | +Inquiry |
CDIPT-3188M | Recombinant Mouse CDIPT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDIPT-7634HCL | Recombinant Human CDIPT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDIPT Products
Required fields are marked with *
My Review for All CDIPT Products
Required fields are marked with *