Recombinant Human CDK11A Protein, GST-Tagged

Cat.No. : CDK11A-0922H
Product Overview : Human CDK11A partial ORF (NP_277073, 681 a.a. - 780 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighboring gene. These two genes are frequently deleted or altered in neuroblastoma. The protein kinase encoded by this gene can be cleaved by caspases and may play a role in cell apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Molecular Mass : 36.63 kDa
AA Sequence : GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDK11A cyclin dependent kinase 11A [ Homo sapiens (human) ]
Official Symbol CDK11A
Synonyms CDK11A; cyclin dependent kinase 11A; CDC2L2; cell division cycle 2-like 2 (PITSLRE proteins); CDC2L2, CDC2L3, cell division cycle 2 like 2, cell division cycle 2 like 2 (PITSLRE proteins); cell division cycle 2-like 2; CDK11 p46; CDK11 p58; CDK11 p110; p58GTA; PITSLRE; CDC2L3; CDK11-p46; CDK11-p58; CDK11-p110; MGC131975; cyclin-dependent kinase 11A; PITSLRE B; PITSLRE protein kinase beta SV1 isoform; PITSLRE protein kinase beta SV16 isoform; PITSLRE protein kinase beta SV17 isoform; PITSLRE protein kinase beta SV18 isoform; PITSLRE protein kinase beta SV2 isoform; PITSLRE protein kinase beta SV3 isoform; PITSLRE protein kinase beta SV6 isoform; PITSLRE serine/threonine-protein kinase CDC2L2; cell division cycle 2-like 2 (PITSLRE proteins); cell division cycle 2-like protein kinase 2; cell division protein kinase 11A; galactosyltransferase-associated protein kinase p58/GTA; EC 2.7.11.22
Gene ID 728642
mRNA Refseq NM_001313896
Protein Refseq NP_001300825
MIM 116951
UniProt ID Q9UQ88

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK11A Products

Required fields are marked with *

My Review for All CDK11A Products

Required fields are marked with *

0
cart-icon
0
compare icon