Recombinant Human CDK11A Protein, GST-Tagged
| Cat.No. : | CDK11A-0922H |
| Product Overview : | Human CDK11A partial ORF (NP_277073, 681 a.a. - 780 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighboring gene. These two genes are frequently deleted or altered in neuroblastoma. The protein kinase encoded by this gene can be cleaved by caspases and may play a role in cell apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDK11A cyclin dependent kinase 11A [ Homo sapiens (human) ] |
| Official Symbol | CDK11A |
| Synonyms | CDK11A; cyclin dependent kinase 11A; CDC2L2; cell division cycle 2-like 2 (PITSLRE proteins); CDC2L2, CDC2L3, cell division cycle 2 like 2, cell division cycle 2 like 2 (PITSLRE proteins); cell division cycle 2-like 2; CDK11 p46; CDK11 p58; CDK11 p110; p58GTA; PITSLRE; CDC2L3; CDK11-p46; CDK11-p58; CDK11-p110; MGC131975; cyclin-dependent kinase 11A; PITSLRE B; PITSLRE protein kinase beta SV1 isoform; PITSLRE protein kinase beta SV16 isoform; PITSLRE protein kinase beta SV17 isoform; PITSLRE protein kinase beta SV18 isoform; PITSLRE protein kinase beta SV2 isoform; PITSLRE protein kinase beta SV3 isoform; PITSLRE protein kinase beta SV6 isoform; PITSLRE serine/threonine-protein kinase CDC2L2; cell division cycle 2-like 2 (PITSLRE proteins); cell division cycle 2-like protein kinase 2; cell division protein kinase 11A; galactosyltransferase-associated protein kinase p58/GTA; EC 2.7.11.22 |
| Gene ID | 728642 |
| mRNA Refseq | NM_001313896 |
| Protein Refseq | NP_001300825 |
| MIM | 116951 |
| UniProt ID | Q9UQ88 |
| ◆ Recombinant Proteins | ||
| CDK11A-26652TH | Recombinant Human CDK11A, His-tagged | +Inquiry |
| CDK11A-285H | Recombinant Human CDK11A protein, GST-tagged | +Inquiry |
| CDK11A-0922H | Recombinant Human CDK11A Protein, GST-Tagged | +Inquiry |
| CDK11A-722H | Recombinant Human CDK11A Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK11A Products
Required fields are marked with *
My Review for All CDK11A Products
Required fields are marked with *
