Recombinant Full Length Human CDK4 Protein, GST-tagged
| Cat.No. : | CDK4-3183HF |
| Product Overview : | Human CDK4 full-length ORF (AAH03644, 211 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 211-303 amino acids |
| Description : | The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 35.97 kDa |
| AA Sequence : | KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDK4 cyclin-dependent kinase 4 [ Homo sapiens ] |
| Official Symbol | CDK4 |
| Synonyms | CDK4; cyclin-dependent kinase 4; PSK J3; cell division protein kinase 4; CMM3; PSK-J3; MGC14458; |
| Gene ID | 1019 |
| mRNA Refseq | NM_000075 |
| Protein Refseq | NP_000066 |
| MIM | 123829 |
| UniProt ID | P11802 |
| ◆ Recombinant Proteins | ||
| CDK4/CCND3-275H | Recombinant Human CDK4/CCND3, GST-tagged, Active | +Inquiry |
| CDK4-927HFL | Recombinant Full Length Human CDK4 Protein, C-Flag-tagged | +Inquiry |
| Cdk4-5846M | Recombinant Mouse Cdk4 protein, His-tagged | +Inquiry |
| CDK4-4867HF | Active Recombinant Full Length Human CDK4 Protein, GST-tagged | +Inquiry |
| CDK4-784R | Recombinant Rhesus monkey CDK4 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDK4-664HCL | Recombinant Human CDK4 cell lysate | +Inquiry |
| CDK4-477HKCL | Human CDK4 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK4 Products
Required fields are marked with *
My Review for All CDK4 Products
Required fields are marked with *
