Recombinant Full Length Human CDK4 Protein, GST-tagged

Cat.No. : CDK4-3183HF
Product Overview : Human CDK4 full-length ORF (AAH03644, 211 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 211-303 amino acids
Description : The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.97 kDa
AA Sequence : KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDK4 cyclin-dependent kinase 4 [ Homo sapiens ]
Official Symbol CDK4
Synonyms CDK4; cyclin-dependent kinase 4; PSK J3; cell division protein kinase 4; CMM3; PSK-J3; MGC14458;
Gene ID 1019
mRNA Refseq NM_000075
Protein Refseq NP_000066
MIM 123829
UniProt ID P11802

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK4 Products

Required fields are marked with *

My Review for All CDK4 Products

Required fields are marked with *

0
cart-icon