Recombinant Human CDK5R1 protein, His-tagged
Cat.No. : | CDK5R1-11051H |
Product Overview : | Recombinant Human CDK5R1 protein(99-307 aa), fused with His tag, was expressed in E.coli. |
Availability | May 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 99-307 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CDK5R1 cyclin-dependent kinase 5, regulatory subunit 1 (p35) [ Homo sapiens ] |
Official Symbol | CDK5R1 |
Synonyms | CDK5R1; cyclin-dependent kinase 5, regulatory subunit 1 (p35); cyclin-dependent kinase 5 activator 1; Nck5a; p35nck5a; CDK5 activator 1; neuronal CDK5 activator; TPKII regulatory subunit; regulatory partner for CDK5 kinase; tau protein kinase II 23kDa subunit; cyclin-dependent kinase 5 regulatory subunit 1; p23; p25; p35; CDK5R; NCK5A; CDK5P35; MGC33831; |
Gene ID | 8851 |
mRNA Refseq | NM_003885 |
Protein Refseq | NP_003876 |
MIM | 603460 |
UniProt ID | Q15078 |
◆ Recombinant Proteins | ||
CDK5R1-687B | Recombinant Bovine CDK5R1, GST-tagged | +Inquiry |
CDK5R1-612R | Recombinant Rhesus Macaque CDK5R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK5R1-1527M | Recombinant Mouse CDK5R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK5R1-3205M | Recombinant Mouse CDK5R1 Protein | +Inquiry |
CDK5R1-669H | Recombinant Human CDK5R1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK5R1-7625HCL | Recombinant Human CDK5R1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK5R1 Products
Required fields are marked with *
My Review for All CDK5R1 Products
Required fields are marked with *
0
Inquiry Basket