Recombinant Human CDK5R1 protein, His-tagged

Cat.No. : CDK5R1-11051H
Product Overview : Recombinant Human CDK5R1 protein(99-307 aa), fused with His tag, was expressed in E.coli.
Availability January 17, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 99-307 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CDK5R1 cyclin-dependent kinase 5, regulatory subunit 1 (p35) [ Homo sapiens ]
Official Symbol CDK5R1
Synonyms CDK5R1; cyclin-dependent kinase 5, regulatory subunit 1 (p35); cyclin-dependent kinase 5 activator 1; Nck5a; p35nck5a; CDK5 activator 1; neuronal CDK5 activator; TPKII regulatory subunit; regulatory partner for CDK5 kinase; tau protein kinase II 23kDa subunit; cyclin-dependent kinase 5 regulatory subunit 1; p23; p25; p35; CDK5R; NCK5A; CDK5P35; MGC33831;
Gene ID 8851
mRNA Refseq NM_003885
Protein Refseq NP_003876
MIM 603460
UniProt ID Q15078

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK5R1 Products

Required fields are marked with *

My Review for All CDK5R1 Products

Required fields are marked with *

0
cart-icon
0
compare icon