Recombinant Human CDK7 protein(1-346aa)
| Cat.No. : | CDK7-3786H |
| Product Overview : | Recombinant Human CDK7 protein(P50613)(1-346aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-346aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
| Gene Name | CDK7 cyclin-dependent kinase 7 [ Homo sapiens ] |
| Official Symbol | CDK7 |
| Synonyms | CDK7; cyclin-dependent kinase 7; cyclin dependent kinase 7 (homolog of Xenopus MO15 cdk activating kinase) , cyclin dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk activating kinase); CAK; CAK1; CDKN7; MO15; STK1; p39 Mo15; protein kinase; 39 KDa protein kinase; kinase subunit of CAK; CDK-activating kinase 1; serine/threonine kinase stk1; cell division protein kinase 7; serine/threonine protein kinase 1; serine/threonine-protein kinase 1; serine/threonine protein kinase MO15; homolog of Xenopus MO15 Cdk-activating kinase; TFIIH basal transcription factor complex kinase subunit; cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase); HCAK; p39MO15; |
| Gene ID | 1022 |
| mRNA Refseq | NM_001799 |
| Protein Refseq | NP_001790 |
| MIM | 601955 |
| UniProt ID | P50613 |
| ◆ Recombinant Proteins | ||
| CDK7-4488HF | Active Recombinant Full Length Human CDK7 Protein, GST-tagged | +Inquiry |
| CDK7-12210Z | Recombinant Zebrafish CDK7 | +Inquiry |
| Cdk7-1925M | Recombinant Mouse Cdk7 protein, His-tagged | +Inquiry |
| CDK7-1033H | Recombinant Human CDK7 Protein, GST-Tagged | +Inquiry |
| CDK7-3164HF | Recombinant Full Length Human CDK7 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDK7-7621HCL | Recombinant Human CDK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK7 Products
Required fields are marked with *
My Review for All CDK7 Products
Required fields are marked with *



