Recombinant Human CDK7 protein(1-346aa), His-tagged

Cat.No. : CDK7-8372H
Product Overview : Recombinant Human CDK7 protein(P50613)(1-346aa), fused with N-terminal His tag, was expressed in Insect Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 1-346aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 41.5 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Gene Name CDK7 cyclin-dependent kinase 7 [ Homo sapiens ]
Official Symbol CDK7
Synonyms CDK7; cyclin-dependent kinase 7; cyclin dependent kinase 7 (homolog of Xenopus MO15 cdk activating kinase) , cyclin dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk activating kinase); CAK; CAK1; CDKN7; MO15; STK1; p39 Mo15; protein kinase; 39 KDa protein kinase; kinase subunit of CAK; CDK-activating kinase 1; serine/threonine kinase stk1; cell division protein kinase 7; serine/threonine protein kinase 1; serine/threonine-protein kinase 1; serine/threonine protein kinase MO15; homolog of Xenopus MO15 Cdk-activating kinase; TFIIH basal transcription factor complex kinase subunit; cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase); HCAK; p39MO15;
Gene ID 1022
mRNA Refseq NM_001799
Protein Refseq NP_001790
MIM 601955
UniProt ID P50613

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK7 Products

Required fields are marked with *

My Review for All CDK7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon