Recombinant Human CDKAL1 Protein, GST-Tagged

Cat.No. : CDKAL1-1044H
Product Overview : Human CDKAL1 full-length ORF (AAH64145.1, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the methylthiotransferase family. The function of this gene is not known. Genome-wide association studies have linked single nucleotide polymorphisms in an intron of this gene with susceptibilty to type 2 diabetes. [provided by RefSeq, May 2010]
Molecular Mass : 37.4 kDa
AA Sequence : MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITGE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDKAL1 CDK5 regulatory subunit associated protein 1-like 1 [ Homo sapiens ]
Official Symbol CDKAL1
Synonyms CDKAL1; CDK5 regulatory subunit associated protein 1-like 1; threonylcarbamoyladenosine tRNA methylthiotransferase; FLJ20342; tRNA-t(6)A37 methylthiotransferase; FLJ46705; MGC75469;
Gene ID 54901
mRNA Refseq NM_017774
Protein Refseq NP_060244
MIM 611259
UniProt ID Q5VV42

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDKAL1 Products

Required fields are marked with *

My Review for All CDKAL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon