Recombinant Human CDKAL1 Protein, GST-Tagged
| Cat.No. : | CDKAL1-1044H |
| Product Overview : | Human CDKAL1 full-length ORF (AAH64145.1, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the methylthiotransferase family. The function of this gene is not known. Genome-wide association studies have linked single nucleotide polymorphisms in an intron of this gene with susceptibilty to type 2 diabetes. [provided by RefSeq, May 2010] |
| Molecular Mass : | 37.4 kDa |
| AA Sequence : | MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITGE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDKAL1 CDK5 regulatory subunit associated protein 1-like 1 [ Homo sapiens ] |
| Official Symbol | CDKAL1 |
| Synonyms | CDKAL1; CDK5 regulatory subunit associated protein 1-like 1; threonylcarbamoyladenosine tRNA methylthiotransferase; FLJ20342; tRNA-t(6)A37 methylthiotransferase; FLJ46705; MGC75469; |
| Gene ID | 54901 |
| mRNA Refseq | NM_017774 |
| Protein Refseq | NP_060244 |
| MIM | 611259 |
| UniProt ID | Q5VV42 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKAL1 Products
Required fields are marked with *
My Review for All CDKAL1 Products
Required fields are marked with *
