Recombinant Human CDKL5 Protein, GST-Tagged
| Cat.No. : | CDKL5-1052H |
| Product Overview : | Human CDKL5 partial ORF (AAH36091, 722 a.a. - 831 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of Ser/Thr protein kinase family and encodes a phosphorylated protein with protein kinase activity. Mutations in this gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 37.73 kDa |
| AA Sequence : | RPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDKL5 cyclin-dependent kinase-like 5 [ Homo sapiens ] |
| Official Symbol | CDKL5 |
| Synonyms | CDKL5; cyclin-dependent kinase-like 5; serine/threonine kinase 9, STK9; EIEE2; serine/threonine kinase 9; serine/threonine-protein kinase 9; cyclin dependent kinase 5 transcript; ISSX; STK9; |
| Gene ID | 6792 |
| mRNA Refseq | NM_003159 |
| Protein Refseq | NP_003150 |
| MIM | 300203 |
| UniProt ID | O76039 |
| ◆ Recombinant Proteins | ||
| CDKL5-1107H | Recombinant Human CDKL5 protein, His-tagged | +Inquiry |
| CDKL5-7388Z | Recombinant Zebrafish CDKL5 | +Inquiry |
| CDKL5-3658H | Recombinant Human CDKL5 protein, His-tagged | +Inquiry |
| CDKL5-1052H | Recombinant Human CDKL5 Protein, GST-Tagged | +Inquiry |
| CDKL5-7131Z | Recombinant Zebrafish CDKL5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKL5 Products
Required fields are marked with *
My Review for All CDKL5 Products
Required fields are marked with *
