Recombinant Human CDKL5 Protein, GST-Tagged

Cat.No. : CDKL5-1052H
Product Overview : Human CDKL5 partial ORF (AAH36091, 722 a.a. - 831 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of Ser/Thr protein kinase family and encodes a phosphorylated protein with protein kinase activity. Mutations in this gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.73 kDa
AA Sequence : RPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDKL5 cyclin-dependent kinase-like 5 [ Homo sapiens ]
Official Symbol CDKL5
Synonyms CDKL5; cyclin-dependent kinase-like 5; serine/threonine kinase 9, STK9; EIEE2; serine/threonine kinase 9; serine/threonine-protein kinase 9; cyclin dependent kinase 5 transcript; ISSX; STK9;
Gene ID 6792
mRNA Refseq NM_003159
Protein Refseq NP_003150
MIM 300203
UniProt ID O76039

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDKL5 Products

Required fields are marked with *

My Review for All CDKL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon