Recombinant Human CDKL5 Protein, GST-Tagged
Cat.No. : | CDKL5-1052H |
Product Overview : | Human CDKL5 partial ORF (AAH36091, 722 a.a. - 831 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of Ser/Thr protein kinase family and encodes a phosphorylated protein with protein kinase activity. Mutations in this gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | RPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDKL5 cyclin-dependent kinase-like 5 [ Homo sapiens ] |
Official Symbol | CDKL5 |
Synonyms | CDKL5; cyclin-dependent kinase-like 5; serine/threonine kinase 9, STK9; EIEE2; serine/threonine kinase 9; serine/threonine-protein kinase 9; cyclin dependent kinase 5 transcript; ISSX; STK9; |
Gene ID | 6792 |
mRNA Refseq | NM_003159 |
Protein Refseq | NP_003150 |
MIM | 300203 |
UniProt ID | O76039 |
◆ Recombinant Proteins | ||
CDKL5-7131Z | Recombinant Zebrafish CDKL5 | +Inquiry |
CDKL5-1107H | Recombinant Human CDKL5 protein, His-tagged | +Inquiry |
CDKL5-7022H | Recombinant Human CDKL5 Protein, His-tagged | +Inquiry |
CDKL5-3657H | Recombinant Human CDKL5 protein, His-tagged | +Inquiry |
CDKL5-11060H | Recombinant Human CDKL5, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDKL5 Products
Required fields are marked with *
My Review for All CDKL5 Products
Required fields are marked with *
0
Inquiry Basket