Recombinant Human CDKN1A protein, His-tagged

Cat.No. : CDKN1A-3186H
Product Overview : Recombinant Human CDKN1A protein(72-164 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability May 23, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 72-164 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : GLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
Gene Name CDKN1A cyclin-dependent kinase inhibitor 1A (p21, Cip1) [ Homo sapiens ]
Official Symbol CDKN1A
Synonyms CDKN1A; cyclin-dependent kinase inhibitor 1A (p21, Cip1); CDKN1; cyclin-dependent kinase inhibitor 1; CAP20; CIP1; P21; p21CIP1; p21Cip1/Waf1; SDI1; WAF1; DNA synthesis inhibitor; CDK-interacting protein 1; CDK-interaction protein 1; wild-type p53-activated fragment 1; melanoma differentiation associated protein 6; MDA-6;
Gene ID 1026
mRNA Refseq NM_000389
Protein Refseq NP_000380
MIM 116899
UniProt ID P38936

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACN9 Products

Required fields are marked with *

My Review for All ACN9 Products

Required fields are marked with *

0
cart-icon
0
compare icon