Recombinant Human CDKN1A protein, His-tagged
| Cat.No. : | CDKN1A-3186H |
| Product Overview : | Recombinant Human CDKN1A protein(72-164 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | June 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 72-164 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | GLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP |
| Gene Name | CDKN1A cyclin-dependent kinase inhibitor 1A (p21, Cip1) [ Homo sapiens ] |
| Official Symbol | CDKN1A |
| Synonyms | CDKN1A; cyclin-dependent kinase inhibitor 1A (p21, Cip1); CDKN1; cyclin-dependent kinase inhibitor 1; CAP20; CIP1; P21; p21CIP1; p21Cip1/Waf1; SDI1; WAF1; DNA synthesis inhibitor; CDK-interacting protein 1; CDK-interaction protein 1; wild-type p53-activated fragment 1; melanoma differentiation associated protein 6; MDA-6; |
| Gene ID | 1026 |
| mRNA Refseq | NM_000389 |
| Protein Refseq | NP_000380 |
| MIM | 116899 |
| UniProt ID | P38936 |
| ◆ Recombinant Proteins | ||
| ACN9-108R | Recombinant Rat ACN9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDKN1A-3186H | Recombinant Human CDKN1A protein, His-tagged | +Inquiry |
| ACN9-452R | Recombinant Rat ACN9 Protein | +Inquiry |
| ACN9-9293H | Recombinant Human ACN9, GST-tagged | +Inquiry |
| ACN9-1460Z | Recombinant Zebrafish ACN9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACN9-9092HCL | Recombinant Human ACN9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACN9 Products
Required fields are marked with *
My Review for All ACN9 Products
Required fields are marked with *
