Recombinant Human CDKN1C

Cat.No. : CDKN1C-30575TH
Product Overview : Recombinant fragment (amino acids 1-100) of Human p57 Kip2 with proprietary 26 kDa tag; 100 amino acids (Predicted MW 11.45 kDa), 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. High levels are seen in the placenta while low levels are seen in the liver.
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC
Sequence Similarities : Belongs to the CDI family.
Gene Name CDKN1C cyclin-dependent kinase inhibitor 1C (p57, Kip2) [ Homo sapiens ]
Official Symbol CDKN1C
Synonyms CDKN1C; cyclin-dependent kinase inhibitor 1C (p57, Kip2); Beckwith Wiedemann syndrome , BWCR, BWS; cyclin-dependent kinase inhibitor 1C; KIP2; P57;
Gene ID 1028
mRNA Refseq NM_000076
Protein Refseq NP_000067
MIM 600856
Uniprot ID P49918
Chromosome Location 11p15.5
Pathway Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Endochondral Ossification, organism-specific biosystem; G1 to S cell cycle control, organism-specific biosystem;
Function cyclin-dependent protein kinase inhibitor activity; protein binding; protein kinase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDKN1C Products

Required fields are marked with *

My Review for All CDKN1C Products

Required fields are marked with *

0
cart-icon