Recombinant Human CDKN1C
Cat.No. : | CDKN1C-30575TH |
Product Overview : | Recombinant fragment (amino acids 1-100) of Human p57 Kip2 with proprietary 26 kDa tag; 100 amino acids (Predicted MW 11.45 kDa), 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. High levels are seen in the placenta while low levels are seen in the liver. |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC |
Sequence Similarities : | Belongs to the CDI family. |
Gene Name | CDKN1C cyclin-dependent kinase inhibitor 1C (p57, Kip2) [ Homo sapiens ] |
Official Symbol | CDKN1C |
Synonyms | CDKN1C; cyclin-dependent kinase inhibitor 1C (p57, Kip2); Beckwith Wiedemann syndrome , BWCR, BWS; cyclin-dependent kinase inhibitor 1C; KIP2; P57; |
Gene ID | 1028 |
mRNA Refseq | NM_000076 |
Protein Refseq | NP_000067 |
MIM | 600856 |
Uniprot ID | P49918 |
Chromosome Location | 11p15.5 |
Pathway | Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Endochondral Ossification, organism-specific biosystem; G1 to S cell cycle control, organism-specific biosystem; |
Function | cyclin-dependent protein kinase inhibitor activity; protein binding; protein kinase inhibitor activity; |
◆ Recombinant Proteins | ||
CDKN1C-30575TH | Recombinant Human CDKN1C | +Inquiry |
CDKN1C-11061H | Recombinant Human CDKN1C, His-tagged | +Inquiry |
CDKN1C-1059H | Recombinant Human CDKN1C Protein, GST-Tagged | +Inquiry |
CDKN1C-1536M | Recombinant Mouse CDKN1C Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKN1C-275Z | Recombinant Zebrafish CDKN1C | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN1C Products
Required fields are marked with *
My Review for All CDKN1C Products
Required fields are marked with *